KEGG   Moniliophthora perniciosa: MPER_08303Help
Entry
MPER_08303        CDS       T01089                                 

Definition
(GenBank) hypothetical protein
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
mpr  Moniliophthora perniciosa
Pathway
mpr00330  Arginine and proline metabolism
mpr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MPER_08303
Enzymes [BR:mpr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     MPER_08303
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-ProteinID: EEB93090
UniProt: E2LNB1
AA seq 249 aa AA seqDB search
MGRCNGTLTAAPQDTGTSYRPGARFGPDGIRAGSRRLTLYGGYNVPLEANPFKSGQRIVD
CGDIPVTPYDNKYAIKQIQEGHQSLLHREPFSPLGNDSLTGKPLVPLSTDGKHHPRIITL
GGDHTIVLPLLRSIYSAYGPISVIHFDSHLDTWKPAVFGGAPSDQAAINHGTYFYWASQE
GLIKNGTSIASHGAIRTTLSSLDDYDNDDASGFLRIEAREIDTIGTDGIIQKIRETVGDA
PVYLSIDAS
NT seq 748 nt NT seq  +upstreamnt  +downstreamnt
atgggaagatgcaacggtacattgaccgctgcaccccaggatacaggcactagctaccgt
ccgggtgcacgcttcggaccagatggcatccgagctggctcacgtcgcctcacgctatac
ggtggatacaatgtaccactcgaagctaacccgttcaaatctggtcaaaggatagtcgac
tgtggtgacattccagtaactccttacgacaacaagtacgccatcaagcagatccaagaa
ggacaccaatcccttcttcaccgagagccattttcacctctgggtaacgacagtctgacg
ggaaaacctctcgttcctttgtcgaccgacggaaagcaccatcctcgtatcatcaccctc
ggtggagaccatacaattgtactccctctacttcgttccatctatagcgcctacgggcca
atctctgtcatccattttgactctcatctcgatacatggaaaccagctgttttcggcggc
gcaccttccgatcaagctgcaatcaatcacggtacctatttctactgggctagccaagag
ggattaattaaaaacgggacatcaattgcaagtcacggtgccattcgaacgaccctatcg
agtctggacgactacgacaatgacgatgcctctggtttcctgcgaattgaagctcgagaa
atcgacacgattggtactgatggaataatccaaaaaattcgtgaaacagttggagacgcc
ccagtttacctatcgattgatgcaagta

DBGET integrated database retrieval system