KEGG   Moniliophthora perniciosa: MPER_08546Help
Entry
MPER_08546        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mpr  Moniliophthora perniciosa
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MPER_08546
   01212 Fatty acid metabolism
    MPER_08546
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MPER_08546
   00650 Butanoate metabolism
    MPER_08546
  Lipid metabolism
   00062 Fatty acid elongation
    MPER_08546
   00071 Fatty acid degradation
    MPER_08546
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MPER_08546
   00310 Lysine degradation
    MPER_08546
   00380 Tryptophan metabolism
    MPER_08546
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MPER_08546
Enzymes [BR:mpr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MPER_08546
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 266 aa AA seqDB search
MSSTQYEYILTSRPDPSVFQITLNRPKALNALSSPLFIELNKALFEADEDDSIGAIVLTG
SEKAFAAGADIKEMKDKTSMMRCRSLQEQFPRELDSDDQLKKPVIAAVSGYALGGGCELA
LMCDIILASPTAKFGQPEINLGVIPGGGGSQRLALAVGKSRAMEMVLTGRTISANEAADW
GMISRVVGEGEGKVIEEAVSMAKEISSKGRLAVQAGKEAVNAAYEMSLEEGLRLERRLFY
GLFATQDQKEGMAAFAEKRKAQFTHQ
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgtcctctactcaatatgaatatatcttgacctctcggccggatccatccgtcttccaa
atcaccctcaacaggcccaaggcgctgaacgcattgagctcacctctctttattgagctg
aacaaggcccttttcgaagcggatgaagatgattctattggcgcgattgttttgacgggg
tcagaaaaggcatttgctgccggtgcggatatcaaggaaatgaaggacaagacctccatg
atgagatgtcgaagtttacaagaacagtttcctcgagaactggactcagatgaccaactc
aagaaacctgttattgcagctgttagcggatacgctctcggaggaggctgcgaacttgct
ctcatgtgtgacatcatcctagcctcccctaccgcaaagttcggtcaacctgagataaac
ttgggcgtgattccgggaggaggtggatctcagagactggctttggctgtagggaagtcg
cgagcgatggagatggttcttacgggaaggacaatttctgctaatgaagcagcggattgg
ggaatgatcagccgtgttgtgggagaaggtgaagggaaggtaatcgaggaggcggtatcc
atggccaaggaaatctccagcaaaggccgtctcgcagttcaggccggaaaggaagctgtc
aatgcagcatatgaaatgtctctggaggaaggactcaggctcgagcgccgactattctat
ggtctattcgctacccaagaccagaaagaaggcatggccgcctttgctgaaaagcggaag
gctcagttcacacaccagtag

DBGET integrated database retrieval system