KEGG   Moniliophthora perniciosa: MPER_08593Help
Entry
MPER_08593        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
mpr  Moniliophthora perniciosa
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    MPER_08593
Enzymes [BR:mpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     MPER_08593
Protein kinases [BR:mpr01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   MPER_08593
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 165 aa AA seqDB search
MSRHSFTALKSTFVVSSEYQFVKELGQGAYGCVVAARHRQTGEGCAIKKITKIGRNAKIT
CLYDMDIVFLPDGNFDEVYLYEELMEADLHAIIRSGQPLTDAHFQSFIYQTLCGLKYIHS
ANVLHRDLKPGNLLVNADCQLKICDFGLARGYTPGSGTSKAAGNQ
NT seq 496 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagacacagcttcaccgctctcaaatcgacattcgtcgtcagctctgaataccaa
ttcgttaaggagctcggccaaggtgcttatggttgtgttgtcgcggctcgacatcgccag
actggggaagggtgtgcaatcaagaagatcacaaagataggccgcaatgcaaagataact
tgcctgtatgatatggacattgtgttcctccccgacgggaattttgacgaggtttatctc
tatgaggaactcatggaagctgatctacatgcaattattcgctcgggccagccgctcact
gatgcccatttccaatctttcatctatcaaaccctctgtggtctcaaatacattcactct
gccaatgttcttcatcgtgatctcaagcctggtaatctactcgtgaacgccgattgtcag
ctcaagatttgcgattttggtcttgcacgaggctatacaccaggaagcggcacatccaaa
gccgctggaaaccaag

  All links  
No link information was found.   
DBGET integrated database retrieval system