KEGG   Moniliophthora perniciosa: MPER_08593Help
Entry
MPER_08593        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
mpr  Moniliophthora perniciosa
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:mpr04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 165 aa AA seqDB search
MSRHSFTALKSTFVVSSEYQFVKELGQGAYGCVVAARHRQTGEGCAIKKITKIGRNAKIT
CLYDMDIVFLPDGNFDEVYLYEELMEADLHAIIRSGQPLTDAHFQSFIYQTLCGLKYIHS
ANVLHRDLKPGNLLVNADCQLKICDFGLARGYTPGSGTSKAAGNQ
NT seq 496 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagacacagcttcaccgctctcaaatcgacattcgtcgtcagctctgaataccaa
ttcgttaaggagctcggccaaggtgcttatggttgtgttgtcgcggctcgacatcgccag
actggggaagggtgtgcaatcaagaagatcacaaagataggccgcaatgcaaagataact
tgcctgtatgatatggacattgtgttcctccccgacgggaattttgacgaggtttatctc
tatgaggaactcatggaagctgatctacatgcaattattcgctcgggccagccgctcact
gatgcccatttccaatctttcatctatcaaaccctctgtggtctcaaatacattcactct
gccaatgttcttcatcgtgatctcaagcctggtaatctactcgtgaacgccgattgtcag
ctcaagatttgcgattttggtcttgcacgaggctatacaccaggaagcggcacatccaaa
gccgctggaaaccaag

DBGET integrated database retrieval system