KEGG   Moniliophthora perniciosa: MPER_08907Help
Entry
MPER_08907        CDS       T01089                                 

Definition
(GenBank) hypothetical protein
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
mpr  Moniliophthora perniciosa
Pathway
mpr00562  Inositol phosphate metabolism
mpr01100  Metabolic pathways
mpr04070  Phosphatidylinositol signaling system
mpr04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    MPER_08907
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    MPER_08907
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    MPER_08907
Enzymes [BR:mpr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     MPER_08907
Membrane trafficking [BR:mpr04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    MPER_08907
 Endocytosis
  Macropinocytosis
   Phospholipase C
    MPER_08907
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X
Motif
Other DBs
NCBI-ProteinID: EEB92562
UniProt: E2LPT9
AA seq 290 aa AA seqDB search
MADSQDEEWQDQLGDQFRVDTIHNLVPPAEHARISPDMEEFIKSKGLSPEEVLQTPVLSV
PENDDSHPLSHYFISSSHNTYLLCRQLVGRSSAASYAHVISRNGRCVEIDVWPSSKGPIV
THGHTFSKSVTFKSVCVAIGNSVWPGDWPVFVSLECHITTEGQAEMIKIMKDAWGDKLVE
KQVEHINRDHVSPRDLRGRILLMIEFYPPDADQMLSSSSPSSSSPSSDDELNDNDEVPRP
DVEHEGRGKISVELADLGFYARSMKPTPGWLQQDLTDPRNILINISEPGL
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggccgactctcaagatgaagaatggcaagaccagcttggagaccagttccgcgttgac
acgattcacaatctcgttccacccgctgaacacgctcgaatcagccctgacatggaggaa
ttcatcaaatccaagggattgtcaccagaagaagtcttacagaccccagtactatcggta
cccgaaaatgacgattcacaccctctgtcacattacttcatttcgtcatcgcataacacc
tatctcctttgccgccaactggtcggtcgctcgtcagctgcttcctatgcgcatgtcata
tctcgaaacgggcgttgcgttgaaatcgacgtatggcccagctcaaagggtccaatcgtc
acccacggacacacctttagcaaaagcgtcactttcaagagtgtctgcgtagctataggt
aactccgtatggccgggagactggcccgtttttgttagtctggagtgccatatcaccacg
gaaggccaagcggagatgatcaagattatgaaggatgcatggggagacaagcttgttgag
aagcaggtcgagcatatcaacagagaccatgtgtcgcctagagatttacgcggaaggatt
ctgcttatgatcgagttttatcctccagatgccgaccaaatgttgtcatcatcatcacca
tcatcatcatctccgtcctcggatgatgaactgaacgataacgacgaggtaccgcggcca
gacgttgaacacgagggcagaggcaaaatttcagttgagctggccgatttaggcttttac
gcccggagtatgaaacctacgccgggttggctacagcaggatctaaccgacccccgcaat
attcttattaacatctccgaacctgggcta

DBGET integrated database retrieval system