KEGG   Moniliophthora perniciosa: MPER_08907Help
Entry
MPER_08907        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
mpr  Moniliophthora perniciosa
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:mpr00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:mpr04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 290 aa AA seqDB search
MADSQDEEWQDQLGDQFRVDTIHNLVPPAEHARISPDMEEFIKSKGLSPEEVLQTPVLSV
PENDDSHPLSHYFISSSHNTYLLCRQLVGRSSAASYAHVISRNGRCVEIDVWPSSKGPIV
THGHTFSKSVTFKSVCVAIGNSVWPGDWPVFVSLECHITTEGQAEMIKIMKDAWGDKLVE
KQVEHINRDHVSPRDLRGRILLMIEFYPPDADQMLSSSSPSSSSPSSDDELNDNDEVPRP
DVEHEGRGKISVELADLGFYARSMKPTPGWLQQDLTDPRNILINISEPGL
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggccgactctcaagatgaagaatggcaagaccagcttggagaccagttccgcgttgac
acgattcacaatctcgttccacccgctgaacacgctcgaatcagccctgacatggaggaa
ttcatcaaatccaagggattgtcaccagaagaagtcttacagaccccagtactatcggta
cccgaaaatgacgattcacaccctctgtcacattacttcatttcgtcatcgcataacacc
tatctcctttgccgccaactggtcggtcgctcgtcagctgcttcctatgcgcatgtcata
tctcgaaacgggcgttgcgttgaaatcgacgtatggcccagctcaaagggtccaatcgtc
acccacggacacacctttagcaaaagcgtcactttcaagagtgtctgcgtagctataggt
aactccgtatggccgggagactggcccgtttttgttagtctggagtgccatatcaccacg
gaaggccaagcggagatgatcaagattatgaaggatgcatggggagacaagcttgttgag
aagcaggtcgagcatatcaacagagaccatgtgtcgcctagagatttacgcggaaggatt
ctgcttatgatcgagttttatcctccagatgccgaccaaatgttgtcatcatcatcacca
tcatcatcatctccgtcctcggatgatgaactgaacgataacgacgaggtaccgcggcca
gacgttgaacacgagggcagaggcaaaatttcagttgagctggccgatttaggcttttac
gcccggagtatgaaacctacgccgggttggctacagcaggatctaaccgacccccgcaat
attcttattaacatctccgaacctgggcta

DBGET integrated database retrieval system