KEGG   Moniliophthora perniciosa: MPER_08986Help
Entry
MPER_08986        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mpr  Moniliophthora perniciosa
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 156 aa AA seqDB search
MANNGIFHSERVAQAIAKVDRANYVRNKSDAYEDSPQTIGYGATISAPHMHAYAAEHLLP
YLKPGAKVLDIGSGSGYLVAVLHHLVEGGKVVGIEHVEELVDWSISNLKRDGLGTALESQ
QIKVVAGDGRKGLAGDGPYDAIHVWCCCAYHPRVPR
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacaatggaatttttcattcagagcgcgttgcacaggcaatagcaaaggtagat
cgggcaaactacgtccgtaacaagtcagatgcatacgaagactcgcctcagactattgga
tacggtgcaaccataagtgcacctcatatgcatgcttacgccgcagagcatctccttccc
tacctgaaaccgggagcaaaagttctggacatcggtagtggatctgggtatcttgttgcc
gttcttcatcatctcgtggaaggaggcaaagtcgtaggcattgaacatgtcgaagaattg
gttgactggtcaattagcaacttgaagcgagatggtttgggtactgctttggagtctcaa
cagattaaagtcgttgccggtgatggacgcaaagggctcgcaggcgatggtccatatgat
gctatccatgtttggtgctgctgcgcctaccatcccagagtccctcgttga

DBGET integrated database retrieval system