KEGG   Moniliophthora perniciosa: MPER_08989Help
Entry
MPER_08989        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
mpr  Moniliophthora perniciosa
Brite
Enzymes [BR:mpr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     MPER_08989
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 154 aa AA seqDB search
QQWSYGPVLLRLAWHAAGTYDKGTKTGGSITLLIDVPLINSLSLDNNYATMRFEPESLHA
ANAGLHVARELMEKVKQEFPWISYGDLWTLGGVAAIQEMAGPKIPWRAGRIDGTVTEATP
DGLLPDATQGSDHLRKTLVRVGPLEICVDGRDWA
NT seq 467 nt NT seq  +upstreamnt  +downstreamnt
atcaacaatggtcctacggccctgtccttctccgtcttgcatggcacgctgctggaacat
acgataagggtaccaagaccggcggcagcataacccttttgattgatgtaccactcatta
actccttatctctcgacaacaactatgccaccatgcgattcgagcctgaatccctccatg
cagccaacgctggcctccacgtcgcccgtgaactcatggaaaaagtcaagcaagaattcc
cctggataagctacggcgacttgtggacgctcggtggtgtcgctgcgatccaggaaatgg
ctggacccaagattccctggagagctggacgtattgacggaacggttactgaggctactc
ccgatggtcttcttcccgacgccacgcaaggatctgatcatttgaggaagactcttgtcc
gcgtggggcctctagaaatttgcgtggacgggcgtgactgggcgtga

DBGET integrated database retrieval system