KEGG   Moniliophthora perniciosa: MPER_09324Help
Entry
MPER_09324        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
mpr  Moniliophthora perniciosa
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 402 aa AA seqDB search
MKRFTNAYMLVYIRESAMDEVLASFTEEDTPPHLKRRLDEERLQIEAKKKEREEQHLFLT
AKVITDETFAQHEGFDLATFDEKNWPPSELPSFRVLKTETYSTFKNRVAQHFKIPDNQVR
LWVLVNRQNKDSVELIRNNMAARQNDLRLYLDVIPDTTKPDPPQQSIMVFLKHFDTSKQT
LFGAGKVYMLRTSKVADLVPIINERMRWAPGTALKLYESEIQDGDVICFQVDLPEREIHD
LESQGLYSNPMQYYDFLQNRVMIIFRPKNEDPDHDHPEFSLVLSKKQNYDTMSMKVGDNL
RHDPIKLRFTTTNAQNGTPKNVLKRSLNQSIAEIMAPYYTTSAVILYEKLDVSIVELETK
RQLKVIWTGIHNKEEGSYPFFYRRPARSRSRGDWRRSYPTTG
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtttcaccaacgcgtatatgttggtgtatatccgggagtctgctatggatgag
gttctagcgtcgttcaccgaagaagatacaccaccacatctgaaacggcgactggacgaa
gagcgtcttcagatcgaggccaagaagaaagagcgggaagagcagcacttgttcctcaca
gcgaaggttatcacggatgaaacattcgctcagcacgaaggatttgatcttgctacattc
gacgagaaaaactggccaccatcagagcttccaagtttccgtgtcctgaaaaccgagacc
tacagtactttcaagaatcgcgtcgcgcaacatttcaagattccggataatcaagtacgg
ttatgggtgctggtgaatcgacaaaacaaagactcggtcgaacttattcgaaacaatatg
gcggcaagacaaaatgatcttcgtctgtatcttgatgtgattccggacacaacaaagccc
gacccaccccaacaatccatcatggtattcttgaagcacttcgatacatccaagcaaact
ttgttcggtgcaggcaaggtgtacatgcttcgtacaagcaaggtcgccgacctcgttcca
atcatcaacgagcgaatgcgatgggcacctggaacggctctcaagttatatgaaagtgaa
atacaggatggtgatgtcatctgcttccaggtcgatctcccagagagagagatccatgac
ctggaaagccaaggtctatattcaaatcctatgcaatactacgatttcctccagaatcgt
gtcatgattatcttccgaccgaagaatgaggacccagatcacgaccacccagagttcagc
cttgtgttaagcaagaagcagaactacgacactatgtcaatgaaagtcggcgataacctt
cgacacgaccccatcaagcttcgtttcaccaccaccaatgctcagaacggtacaccaaag
aacgttctgaagcgatcactgaaccaaagcatagcggagataatggcgccatactacacg
acaagtgccgttatcctctacgagaagttggatgttagtattgtggagctagagaccaag
cgtcagctgaaggttatctggactggaattcacaacaaggaggaggggtcgtatcctttc
ttttaccgaagaccagctcggtcacgatctcgcggagattggcgaagaagttaccctacc
actggt

DBGET integrated database retrieval system