KEGG   Moniliophthora perniciosa: MPER_09545Help
Entry
MPER_09545        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K08738  
cytochrome c
Organism
mpr  Moniliophthora perniciosa
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    MPER_09545
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 85 aa AA seqDB search
MPYAAGVFNSNPAHSHIFGRKSGQVDGFSYTAANVNKGVTWDEHTFLEYLENPKKYIPGT
KMAFAGLKKEKDRNDLITYLKEATA
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atgccttacgctgccggtgtgttcaactcaaaccctgctcattctcatatttttggccgc
aagagtggacaagtagatggcttttcatataccgctgccaacgtcaacaagggtgttaca
tgggacgagcacacattcttggagtacctcgaaaaccccaaaaagtatattcctggaacg
aagatggcattcgctggcttgaagaaggaaaaggacaggaatgacctaatcacctacttg
aaggaagctaccgcctaa

DBGET integrated database retrieval system