KEGG   Moniliophthora perniciosa: MPER_10149Help
Entry
MPER_10149        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
mpr  Moniliophthora perniciosa
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 298 aa AA seqDB search
MRGRETPTSENGHLNGNVFVVTRDNVKEHHLVPRKPPDQLPIVLQVLLSQPHRLRALILL
SQFVDLGPWAVNLVLTIGIFPYISKLLQAPGPDLRPVLIFIWARILAVDPSVQSDLFNNA
QGYRYFSNILAMKPDSAHVLPNSSEHQAMCSFILAALARNFQKGQQACWEESVFQSCYER
LEEPDFLLRQWTALCIAQMWCGFDEGKMIGVNRGTQDKLTHLLSDDSAEVRCAALYALGT
FMGASGSREVEKRGGGGSGAMYDLDERDHFRMEVAVVTGATLVVKDDASPMCRKSCWY
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgcgtggacgagagaccccaaccagcgagaacggacatttgaacggcaatgtgttcgtc
gtaacaagggataacgtcaaagagcatcaccttgttccgcgcaaacctcccgaccaactt
cctatcgtgcttcaagtccttctatctcaaccccatcgacttcgtgccctcattcttctc
tcccaattcgttgaccttggtccatgggccgtcaatctggtgcttaccattggtatcttc
ccttacatatcgaagctcttacaagcaccaggacctgacctgcgacccgtcctcatattc
atctgggcgcgtattcttgctgtagacccctctgtacagagcgatctattcaacaatgca
caaggatacaggtacttctctaatattcttgcgatgaaacccgacagtgcacacgtcctc
cccaactcgtccgagcatcaagccatgtgctcattcatactggctgcgcttgctagaaat
ttccaaaagggtcagcaagcatgttgggaggagagcgtcttccaatcgtgttatgaaagg
ctcgaggaacccgatttcctgcttcgccagtggacggcactttgtatagcgcagatgtgg
tgcggatttgatgagggaaagatgatcggtgtcaaccgtggcacacaagataaacttaca
cacctgctctcagatgactctgcagaggtccgttgcgcagctctgtatgcattgggcaca
ttcatgggcgcatctggatcccgggaagttgagaaaagaggcggaggtggaagcggtgca
atgtatgatcttgatgagagggaccatttccggatggaagtggcagttgtcacgggtgcg
actttggttgtcaaagatgatgccagtccgatgtgcagaaagagctgttggtattga

DBGET integrated database retrieval system