KEGG   Moniliophthora perniciosa: MPER_10173Help
Entry
MPER_10173        CDS       T01089                                 

Definition
(GenBank) hypothetical protein
  KO
K00505  tyrosinase [EC:1.14.18.1]
Organism
mpr  Moniliophthora perniciosa
Pathway
mpr00350  Tyrosine metabolism
mpr01100  Metabolic pathways
mpr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    MPER_10173
Enzymes [BR:mpr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     MPER_10173
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tyrosinase HMG_box_2
Motif
Other DBs
NCBI-ProteinID: EEB91461
UniProt: E2LSZ0
AA seq 302 aa AA seqDB search
MLTLRVGLLALLIIVQICTAAPGVNGPPPSPNKCSSPTVRHEWRALSTAEKQAYIDAVKC
LQRLPSRAAAIKEAKTRFDDFQSVHIVLAPDVHLVGQFLAWHRFYLHLYEKALREECGYK
GSQPYWDWTLDIKDGLTSFAASPVFDPTYGFGGNGADIPGYNGFFNNVSEIPDWEYGGPG
GGCIQDGPFASYNLSLGPGTLNRNHCISRWFTPVYLKTVTEKNVSKLFTFDTFEESRIEL
EGTPITKHAKPNDGAHLAVGGEMGDRYSSPGNLSLSSYTIGRSVECTVTSAMVKIGGQRP
SQ
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgctcactctccgagtaggacttctagcactactaatcatcgtccaaatttgcaccgcg
gcacccggagttaatggcccacctccgagtccgaataaatgctcttcgcctactgtacga
cacgaatggcgtgcgctcagtacagctgagaagcaagcgtacatcgacgccgtgaaatgt
ctgcaaagactgccctcccgagctgctgctatcaaagaggccaagacgcgtttcgacgat
tttcaaagcgtccacattgttttagctcctgatgtccatttagtgggccaatttctcgct
tggcaccggttctatcttcacctgtatgaaaaggcgcttcgcgaagaatgcggttataag
ggttcacagccatactgggactggacactcgatatcaaagatggactcacgtcgttcgcg
gcttctccagtctttgacccgacctacggttttggaggaaatggagctgatataccaggt
tacaatggtttcttcaataacgtgtcagagataccggactgggagtacggcggacccgga
ggaggatgcatccaagacggcccattcgcatcctacaatctatccctcggcccaggaacc
ttaaacaggaatcattgcatctcacgatggtttaccccggtataccttaaaacggtcact
gaaaagaatgtatcaaaacttttcacctttgacacgtttgaagagtcccggatcgagttg
gagggcacaccaattacgaaacacgcaaagccgaatgatggcgctcatttagcggtaggc
ggtgagatgggtgaccggtactcgagcccaggaaatctctctctatcttcatacacaatt
ggtcgatctgtggagtgcacagtaacctctgcgatggtgaaaattggcggacagcgaccc
tcccagtga

DBGET integrated database retrieval system