KEGG   Moniliophthora perniciosa: MPER_10471Help
Entry
MPER_10471        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
mpr  Moniliophthora perniciosa
Pathway
Fatty acid degradation
Tryptophan metabolism
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    MPER_10471
  Amino acid metabolism
   00380 Tryptophan metabolism
    MPER_10471
Enzymes [BR:mpr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     MPER_10471
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     MPER_10471
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 209 aa AA seqDB search
MDSLKVLLLSSYGEIYQLNVLGDVSITLNTNALINEVCDEKRFHKLVGGALYRTRDLIGD
GLFTAFDHESNWGLAHRLLMPAFGTLSVRGMMEDMRDICTQLLLKWERFGPDHAIDPVDD
FTRTTFDTLAYCCLSYSAMSDFLAAAFVRSARPALVQALHPSENAKYQSDMKIMKDLAMK
IVADRRANPTEKKDILNVLLYGRDPKTGR
NT seq 628 nt NT seq  +upstreamnt  +downstreamnt
atggattcattaaaggtcttactactctcctcgtatggggagatctatcagctcaatgtc
cttggcgacgtctccattactctgaacacaaacgcgttgataaacgaggtctgcgatgag
aagcgcttccataagctcgttggaggtgctttgtatcgaactagagatttaattggggat
ggcctgtttacggcctttgaccacgagagtaactggggacttgctcatcgccttctcatg
cctgcgttcggcactctttctgttcgcgggatgatggaggacatgcgtgatatttgcact
cagctgctcctcaaatgggaacgctttggacccgaccatgccatcgatcccgtggatgac
tttaccagaacaacattcgacactttggcgtactgctgtttgtcgtacagtgcaatgtcc
gatttcctcgctgcagcctttgttcgatcggctaggcctgctcttgtacaagccctacac
ccttccgaaaacgccaaatatcagtctgacatgaagatcatgaaggatttagctatgaaa
atcgttgcggaccgtagagcaaatcctactgaaaagaaggatattctcaatgttctgctg
tatggcagagatccaaagacaggacgag

DBGET integrated database retrieval system