KEGG   Moniliophthora perniciosa: MPER_10652Help
Entry
MPER_10652        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
mpr  Moniliophthora perniciosa
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 263 aa AA seqDB search
MSCTHLSQIATLPSPKLSQSVHREECTQCFDGQDSDAGVDAADEEPPLKMTKLAIVEERE
EDKYEFITAIRCYKCNPDGVTIPDSELTAQPAIATLVKNVLTTQSSARKSEVQAWEEEIL
PCEHTLTLQQVQMSKEGLEKVIGQGAHCTNCSLTSNLWLCLTCGNLGCGRAQFGGVEGNG
HGLAHFEMTRDLGEVHPVSVKLGTITAEGNADIYCYVCNDSKLDPELAKHLATFGIRVES
QQKTEKSMSELVTPCLFITFPLG
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgtactcatctcagccagatcgccactcttccatcccccaaactttctcaatct
gtgcatcgagaggaatgtacacagtgtttcgatgggcaggacagcgatgctggagtcgac
gctgcagacgaggaaccgccactcaagatgaccaagcttgctattgtagaagagcgtgaa
gaagacaaatacgagtttattacagctatacggtgctacaaatgcaacccagacggcgtc
acgattcctgattctgagctcactgcgcaaccagcaatcgctacccttgtaaagaatgtt
ctcactacacagtcttcggcgcgcaagtctgaagtgcaggcttgggaagaggagatattg
ccctgtgaacacactttgacgcttcaacaagtgcagatgagcaaggaggggctagagaag
gtcattggacaaggcgcacactgtacaaattgctcattgacctcaaacttgtggctttgc
ttaacatgcggaaatcttggttgtggacgagcgcaattcggtggtgtcgaagggaacggt
catggtttggctcactttgagatgaccagagaccttggagaggttcatcctgttagtgtt
aagcttgggacgattaccgcagaaggaaacgcagacatctactgctatgtgtgcaacgac
tcgaaacttgacccagaactcgcaaagcatctcgcaacatttggtatcagggttgagtct
cagcaaaaaactgagaagagcatgagcgaattggtgacgccttgtctattcataacattt
cctcttggctaa

DBGET integrated database retrieval system