KEGG   Moniliophthora perniciosa: MPER_10652Help
Entry
MPER_10652        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.4.19.12]
Organism
mpr  Moniliophthora perniciosa
Brite
Enzymes [BR:mpr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     MPER_10652
Peptidases [BR:mpr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   MPER_10652
Exosome [BR:mpr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   MPER_10652
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 263 aa AA seqDB search
MSCTHLSQIATLPSPKLSQSVHREECTQCFDGQDSDAGVDAADEEPPLKMTKLAIVEERE
EDKYEFITAIRCYKCNPDGVTIPDSELTAQPAIATLVKNVLTTQSSARKSEVQAWEEEIL
PCEHTLTLQQVQMSKEGLEKVIGQGAHCTNCSLTSNLWLCLTCGNLGCGRAQFGGVEGNG
HGLAHFEMTRDLGEVHPVSVKLGTITAEGNADIYCYVCNDSKLDPELAKHLATFGIRVES
QQKTEKSMSELVTPCLFITFPLG
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgtactcatctcagccagatcgccactcttccatcccccaaactttctcaatct
gtgcatcgagaggaatgtacacagtgtttcgatgggcaggacagcgatgctggagtcgac
gctgcagacgaggaaccgccactcaagatgaccaagcttgctattgtagaagagcgtgaa
gaagacaaatacgagtttattacagctatacggtgctacaaatgcaacccagacggcgtc
acgattcctgattctgagctcactgcgcaaccagcaatcgctacccttgtaaagaatgtt
ctcactacacagtcttcggcgcgcaagtctgaagtgcaggcttgggaagaggagatattg
ccctgtgaacacactttgacgcttcaacaagtgcagatgagcaaggaggggctagagaag
gtcattggacaaggcgcacactgtacaaattgctcattgacctcaaacttgtggctttgc
ttaacatgcggaaatcttggttgtggacgagcgcaattcggtggtgtcgaagggaacggt
catggtttggctcactttgagatgaccagagaccttggagaggttcatcctgttagtgtt
aagcttgggacgattaccgcagaaggaaacgcagacatctactgctatgtgtgcaacgac
tcgaaacttgacccagaactcgcaaagcatctcgcaacatttggtatcagggttgagtct
cagcaaaaaactgagaagagcatgagcgaattggtgacgccttgtctattcataacattt
cctcttggctaa

DBGET integrated database retrieval system