KEGG   Moniliophthora perniciosa: MPER_10713Help
Entry
MPER_10713        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
mpr  Moniliophthora perniciosa
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 306 aa AA seqDB search
MNSFIKEQHKYNVGDDCPVFEGLFDYCSISAGGSMEGAARLSRDKCDIAINWAGGLHHAK
KSEASGFCYVNDIVLGILELLRYHQRVLYIDIDVHHGDGVEEAFFTTDRVMTVSFHKFGE
FFPGTGEVRDTGFGKGKNYSLNFPLRDGVTDENYKSVFEPVINEVMASYNPDAIVLQCGA
DSLSGDKIGSLNLSMRGHANCVKFVRSLNKPLLMLGGGGYTIRNVSRTWAYETGIAAGVE
LQPEIPTPVDYYEYFGPDYQLDVKPSNADDMNTPAYLDSIKGIVLTNLRNLGGPPSVQLT
GMYSPS
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaattcgtttatcaaggagcaacataaatataatgtcggcgacgactgtcctgttttt
gaagggttattcgattactgttctatttccgctggaggctcaatggagggtgctgcgagg
ttatcgagagataaatgtgacatcgcaataaactgggctggagggcttcatcacgcaaag
aaaagcgaagcgagcggtttctgttatgttaatgacatcgttcttgggattcttgagctc
ctacgatatcatcagcgtgtcttatacattgacattgatgtacatcatggagatggcgtc
gaagaggcctttttcaccactgatcgggtgatgacagtcagctttcataaatttggggaa
tttttccctggcaccggggaagtgagggacaccggttttgggaaaggaaaaaactactcg
ctgaatttccccctccgagatggtgtaacggacgaaaactacaagtctgtatttgaaccg
gtcattaatgaagtcatggcgtcctacaatccagatgctatcgttttacagtgtggcgcc
gactctctctctggtgacaagattggtagtctgaacctttccatgcgagggcacgcaaac
tgcgtcaaatttgttagatctttgaacaagcctttgctgatgctgggcgggggaggctat
acaatccgcaacgtcagtcgtacttgggcttacgagactggtattgctgcgggcgtcgag
ctccaacccgaaataccgactcctgtcgactactacgagtactttgggccagactatcaa
cttgacgtgaagccttctaacgccgatgatatgaacactccagcctacttggacagcatc
aaaggaattgtcttaacaaatctcaggaatcttggtggccccccgagtgttcagcttact
ggtatgtacagcccaagttaa

DBGET integrated database retrieval system