KEGG   Moniliophthora perniciosa: MPER_10816Help
Entry
MPER_10816        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K12858  
ATP-dependent RNA helicase DDX23/PRP28 [EC:3.6.4.13]
Organism
mpr  Moniliophthora perniciosa
Pathway
Spliceosome
Class
Genetic Information Processing; Transcription; Spliceosome [PATH:mpr03040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 303 aa AA seqDB search
MTSTNRSEPLSIESLLQKQREEKEAAAKPKFLSKEARAQLAIAKRAAEISEQRKKEEEAR
RDRETLEKEAEELRRREGGQANKFGRYEDSSNSRYAHPERDRGPRGRGRGSHHRGDRDRD
RDKDRDYGNVPTGPRADRSKPSTTANTPQASSSHSTSNTPGPQSSGSGAATPTPGTDGNY
SPDVDMDAIRTRYLGVDKKKRKIRKTNDRKFVFDWDAQDDTAEDSSVVPASNQGPQPMFG
RGHLAGIDLAHDLSTQDHLADTRERRKALKTGIDERHWTEKPLNEMRERDWRIFREDFSI
SAR
NT seq 910 nt NT seq  +upstreamnt  +downstreamnt
atgacttcaacaaatcgctctgaacctctttcaatcgaatctttgctccagaagcagcga
gaagagaaggaggctgctgcaaagcctaaatttctctctaaggaagctcgggcacagctt
gctatcgcgaagcgtgcggcggaaatctcagagcagagaaagaaagaggaggaggctagg
agagacagagaaacattggaaaaagaagccgaagaactaaggagacgggagggaggtcag
gcgaataagtttggacgatatgaagattcttccaattctcgatacgcacatcctgaacgc
gatcgtggccctcgtggtcgtggacgaggcagtcaccatcgtggagacagggacagagac
agagacaaagatagagactatggaaatgtacccactggtcctcgggctgaccgctctaaa
ccatctacaacagccaatacgcctcaagcttcctcttctcattcgacgtcaaatacacct
ggtcctcagagtagcggttcaggagcagcaactcctacgcccggaactgatggaaactac
tcaccagatgttgacatggatgcaatccgcacgcgttacctcggtgttgacaaaaagaag
cgcaaaatcagaaagacaaatgatagaaaatttgtgtttgattgggatgcccaggatgat
actgccgaagactcgagtgtcgttccagcgtctaatcagggaccacaacccatgtttggt
cgtggtcatctcgccggtatagacctcgcccatgatctttcaactcaggatcatttggcc
gatacaagagaaaggcgaaaagctttgaagacaggcatagacgaacgccactggaccgaa
aaaccgctgaacgaaatgagggaacgagattggagaatcttcagagaggacttcagtatc
agtgccagag

DBGET integrated database retrieval system