KEGG   Moniliophthora perniciosa: MPER_10816Help
Entry
MPER_10816        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K12858  
ATP-dependent RNA helicase DDX23/PRP28 [EC:3.6.4.13]
Organism
mpr  Moniliophthora perniciosa
Pathway
Spliceosome
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    MPER_10816
Enzymes [BR:mpr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     MPER_10816
Spliceosome [BR:mpr03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U5 snRNP specific factors
    MPER_10816
 Complex C
   U5 SnRNP specific factors
    MPER_10816
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 303 aa AA seqDB search
MTSTNRSEPLSIESLLQKQREEKEAAAKPKFLSKEARAQLAIAKRAAEISEQRKKEEEAR
RDRETLEKEAEELRRREGGQANKFGRYEDSSNSRYAHPERDRGPRGRGRGSHHRGDRDRD
RDKDRDYGNVPTGPRADRSKPSTTANTPQASSSHSTSNTPGPQSSGSGAATPTPGTDGNY
SPDVDMDAIRTRYLGVDKKKRKIRKTNDRKFVFDWDAQDDTAEDSSVVPASNQGPQPMFG
RGHLAGIDLAHDLSTQDHLADTRERRKALKTGIDERHWTEKPLNEMRERDWRIFREDFSI
SAR
NT seq 910 nt NT seq  +upstreamnt  +downstreamnt
atgacttcaacaaatcgctctgaacctctttcaatcgaatctttgctccagaagcagcga
gaagagaaggaggctgctgcaaagcctaaatttctctctaaggaagctcgggcacagctt
gctatcgcgaagcgtgcggcggaaatctcagagcagagaaagaaagaggaggaggctagg
agagacagagaaacattggaaaaagaagccgaagaactaaggagacgggagggaggtcag
gcgaataagtttggacgatatgaagattcttccaattctcgatacgcacatcctgaacgc
gatcgtggccctcgtggtcgtggacgaggcagtcaccatcgtggagacagggacagagac
agagacaaagatagagactatggaaatgtacccactggtcctcgggctgaccgctctaaa
ccatctacaacagccaatacgcctcaagcttcctcttctcattcgacgtcaaatacacct
ggtcctcagagtagcggttcaggagcagcaactcctacgcccggaactgatggaaactac
tcaccagatgttgacatggatgcaatccgcacgcgttacctcggtgttgacaaaaagaag
cgcaaaatcagaaagacaaatgatagaaaatttgtgtttgattgggatgcccaggatgat
actgccgaagactcgagtgtcgttccagcgtctaatcagggaccacaacccatgtttggt
cgtggtcatctcgccggtatagacctcgcccatgatctttcaactcaggatcatttggcc
gatacaagagaaaggcgaaaagctttgaagacaggcatagacgaacgccactggaccgaa
aaaccgctgaacgaaatgagggaacgagattggagaatcttcagagaggacttcagtatc
agtgccagag

DBGET integrated database retrieval system