KEGG   Moniliophthora perniciosa: MPER_10990Help
Entry
MPER_10990        CDS       T01089                                 

Definition
(GenBank) hypothetical protein
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
mpr  Moniliophthora perniciosa
Pathway
mpr00010  Glycolysis / Gluconeogenesis
mpr00052  Galactose metabolism
mpr01100  Metabolic pathways
mpr01110  Biosynthesis of secondary metabolites
mpr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MPER_10990
   00052 Galactose metabolism
    MPER_10990
Enzymes [BR:mpr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     MPER_10990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldose_epim Exonuc_VIII
Motif
Other DBs
NCBI-ProteinID: EEB90761
UniProt: E2LUZ0
AA seq 330 aa AA seqDB search
SKLLSDPDHPVFNAIVGRYANRLKNGMYLSLLIHTNPAHHRLRTFSIPISKNPPPDGPNV
WHIPTNDHNGQVTLHGGIYGWDRRNWTIVSRSSTSVTYQHIDDGDENWPGKVTVLATHTV
QNGGILKTEVKAKATEKTPIMVTQHIYWNLDGFIGSENILDHHLQVDSSRVVKLDSNAIP
TGELINVGGTPFDFRKESKIGARWSATQGLCGDGCQGYDHCWIYDKDESKKAGTSLWSDN
SGIRVDITTNQPAAQVYTSFWLNTTSKGVHGGPIKRYGRWSAVAIEQEGWIAAVNTPEWG
VDQISCADEFADGPDRDFSWSSQYKFSTVT
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
agcaaactcctgtcggatccagaccatcccgtattcaacgcaatcgtagggcgctacgca
aaccggctgaagaacggtatgtacctttcgctactgatacatacgaaccctgctcaccat
cgactaagaacattctccatcccaatctccaagaacccaccgcccgatggccccaacgtc
tggcacatcccgaccaacgaccataacggccaggtcaccttacacggtggtatctatggc
tgggacagacgcaactggaccatcgtctctcgctcatccaccagcgtgacgtatcaacac
attgacgacggagacgagaactggcctggaaaggtcacggttcttgctactcataccgtt
cagaatggcggtattctcaagacggaggtgaaggccaaggctaccgagaagactccaatc
atggtgacgcagcacatctactggaatctggacgggtttattggctccgagaatatcttg
gatcatcatttgcaggtcgactcgtcccgtgttgtcaagcttgactcgaatgctattcct
accggtgaactcatcaatgttggtggtacacccttcgacttcaggaaggaatccaagatc
ggagcgaggtggagtgctacgcaaggattgtgcggtgatggatgtcaaggttatgaccat
tgctggatctacgataaagacgagagtaagaaggctggaactagtctttggagtgacaac
tctggaattcgggtggacattacgacgaatcaaccagctgctcaggtctacacctccttc
tggctgaacactacgtcaaagggtgtgcatggtggacctattaagcgatatggacgatgg
agtgctgtggccattgagcaggagggttggattgcagctgtcaacacgcccgagtggggt
gttgatcagatttcatgtgctgacgaatttgcagacggccctgacagagacttttcctgg
agttcgcagtacaagttttcgactgtaacgtga

DBGET integrated database retrieval system