KEGG   Moniliophthora perniciosa: MPER_10990Help
Entry
MPER_10990        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
mpr  Moniliophthora perniciosa
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MPER_10990
   00052 Galactose metabolism
    MPER_10990
Enzymes [BR:mpr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     MPER_10990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 330 aa AA seqDB search
SKLLSDPDHPVFNAIVGRYANRLKNGMYLSLLIHTNPAHHRLRTFSIPISKNPPPDGPNV
WHIPTNDHNGQVTLHGGIYGWDRRNWTIVSRSSTSVTYQHIDDGDENWPGKVTVLATHTV
QNGGILKTEVKAKATEKTPIMVTQHIYWNLDGFIGSENILDHHLQVDSSRVVKLDSNAIP
TGELINVGGTPFDFRKESKIGARWSATQGLCGDGCQGYDHCWIYDKDESKKAGTSLWSDN
SGIRVDITTNQPAAQVYTSFWLNTTSKGVHGGPIKRYGRWSAVAIEQEGWIAAVNTPEWG
VDQISCADEFADGPDRDFSWSSQYKFSTVT
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
agcaaactcctgtcggatccagaccatcccgtattcaacgcaatcgtagggcgctacgca
aaccggctgaagaacggtatgtacctttcgctactgatacatacgaaccctgctcaccat
cgactaagaacattctccatcccaatctccaagaacccaccgcccgatggccccaacgtc
tggcacatcccgaccaacgaccataacggccaggtcaccttacacggtggtatctatggc
tgggacagacgcaactggaccatcgtctctcgctcatccaccagcgtgacgtatcaacac
attgacgacggagacgagaactggcctggaaaggtcacggttcttgctactcataccgtt
cagaatggcggtattctcaagacggaggtgaaggccaaggctaccgagaagactccaatc
atggtgacgcagcacatctactggaatctggacgggtttattggctccgagaatatcttg
gatcatcatttgcaggtcgactcgtcccgtgttgtcaagcttgactcgaatgctattcct
accggtgaactcatcaatgttggtggtacacccttcgacttcaggaaggaatccaagatc
ggagcgaggtggagtgctacgcaaggattgtgcggtgatggatgtcaaggttatgaccat
tgctggatctacgataaagacgagagtaagaaggctggaactagtctttggagtgacaac
tctggaattcgggtggacattacgacgaatcaaccagctgctcaggtctacacctccttc
tggctgaacactacgtcaaagggtgtgcatggtggacctattaagcgatatggacgatgg
agtgctgtggccattgagcaggagggttggattgcagctgtcaacacgcccgagtggggt
gttgatcagatttcatgtgctgacgaatttgcagacggccctgacagagacttttcctgg
agttcgcagtacaagttttcgactgtaacgtga

DBGET integrated database retrieval system