KEGG   Moniliophthora perniciosa: MPER_11032Help
Entry
MPER_11032        CDS       T01089                                 

Definition
(GenBank) hypothetical protein
  KO
K11262  acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14 2.1.3.15]
Organism
mpr  Moniliophthora perniciosa
Pathway
mpr00061  Fatty acid biosynthesis
mpr00620  Pyruvate metabolism
mpr00640  Propanoate metabolism
mpr01100  Metabolic pathways
mpr01110  Biosynthesis of secondary metabolites
mpr01130  Biosynthesis of antibiotics
mpr01212  Fatty acid metabolism
Module
mpr_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MPER_11032
   00640 Propanoate metabolism
    MPER_11032
  Lipid metabolism
   00061 Fatty acid biosynthesis
    MPER_11032
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    MPER_11032
Enzymes [BR:mpr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     MPER_11032
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     MPER_11032
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     MPER_11032
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N ATPgrasp_Ter ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: EEB90723
UniProt: E2LV28
AA seq 403 aa AA seqDB search
MSTYDHSRVQHFIGGNSLDNAPPGTVTDFVKNSGGHTVITKASIAAVKEIRSIRQWSYET
FGTERAIEFTVMATPEDLKVNAEYIRMADRYIEVPGGTNNNNYANVDLIVDVAERAGVHA
VWAGWGHASENPRLPESLAASKHKIVFIGPPGSAMRSLGDKISSTIVAQSANVPTMAWSG
TGITDTVLSDAGYVVVPDKVYQDACVSNVEEGLAKAEQIGWPVMIKASEGGGGKGILAGE
IPGSPIFIMKLAGQARHLEVQLVADQYGNAISLFGRDCSVLFRHQKIIEKAPVTIAKGKT
FEQMERAAVRLAKLVGYVSAGTVEYLYNHAEDDFYFLELNPRLQVEHPTTEMVSGVNLPA
AQLQVAMGIPLHRIRHIRQLYGVETNAASENDFDMGESHSLKA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgtccacctacgaccattcccgagtccaacatttcataggtggaaactccctcgacaat
gctcctccgggcaccgtgactgattttgtcaagaactctggtggtcacacagtcatcacc
aaggcaagtatcgccgccgtaaaagaaatcagatccatcaggcaatggagctacgaaacc
tttggcacggaacgtgcaatcgagttcaccgtcatggcgaccccggaagatctcaaggtc
aatgccgagtacattcgcatggctgacagatacatcgaagtacctgggggtactaacaac
aataactacgctaacgttgacctcatcgtcgatgtcgccgaacgtgcaggtgttcatgct
gtttgggctggttggggtcatgcatccgagaacccgcgtcttccagaaagcttagcagcc
agcaagcacaagatcgtcttcatcggtcctccaggaagtgctatgaggagtttgggagac
aagatttcatccacaatcgttgcacagagcgcgaacgtgccaaccatggcgtggtcagga
accggaattaccgacactgtactctctgatgccggatatgtggttgttccggataaggtt
taccaggatgcttgtgtatcaaacgttgaggagggtttggcgaaggctgaacagattgga
tggccggtcatgattaaggctagcgaaggaggtggaggaaaaggtattcttgcaggcgaa
attccaggatcccccatcttcatcatgaagttggcgggccaagcgcggcatcttgaagtt
caactcgtggccgatcaatacggaaacgccatttcgctttttggacgtgactgttccgtg
ctttttcgtcatcagaagattatcgaaaaagcccctgtgactattgctaagggaaagacc
ttcgagcaaatggaacgcgcggccgttcgtttagcgaagcttgtaggatatgtcagtgct
ggaaccgttgaatacttgtacaaccatgctgaggacgacttctatttccttgaactcaat
cctcgtctgcaagttgaacacccaacgactgagatggtctctggtgtcaaccttcccgcc
gctcaactccaagtagcaatgggtattccccttcatcgtatccgacacatccgtcagctc
tatggtgttgaaaccaatgccgcttccgaaaatgactttgatatgggggaatcccattca
cttaaggcttaa

DBGET integrated database retrieval system