KEGG   Moniliophthora perniciosa: MPER_11147Help
Entry
MPER_11147        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
mpr  Moniliophthora perniciosa
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MPER_11147
Enzymes [BR:mpr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     MPER_11147
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 250 aa AA seqDB search
TGDTEDSIRGNVIVSWYLTTLAVAEQLYDALYVWNQQKSLEVTATSLPFFQIFSPSITAG
TYASTSSTYTTLTTAVKSWADGFISVVAKYTPPNGALAEQYNRATGVPLSASDLTWSYAS
ALTAFGARAGQVSASWGAKGLTCTGGGGLPPPSGPTVAATFNVQVTTTFGENIFLTGSVD
ALKNWSPENAISLSSANYPTWSVTVNVPANTAIEYKYIRKFNGAVTWESDPNRRITTPSS
GSFTQNDSWR
NT seq 754 nt NT seq  +upstreamnt  +downstreamnt
tacgggcgataccgaagattctattcgcggtaacgtgatagtctcctggtacttgactac
ccttgccgttgccgagcagctctatgatgctctttatgtttggaaccagcagaaatcact
cgaagttacagccacttctctccccttcttccaaatcttctctcccagtatcactgctgg
cacttatgcctccacttcatctacttacaccactctcaccactgccgtcaagagctgggc
tgatggatttatcagcgtagtcgccaaatataccccgcccaatggagcccttgcagagca
gtacaacagggccactggcgtacctctcagtgcaagtgatctaacatggagttatgcatc
agctttgactgcttttggtgcccgggcaggtcaggtctctgctagctggggagccaaagg
attgacttgcactggcggtggtggtttgccccctcccagtggaccgactgttgctgcaac
tttcaacgttcaagttacgactaccttcggagagaacatcttcctgaccggctccgttga
tgccttgaagaactggtcaccagaaaacgcaatttccttgtcttccgcgaactacccaac
ttggagtgtgactgtcaacgttcctgccaatacggccattgaatacaagtacattcgcaa
gttcaacggcgccgtcacttgggagtctgaccccaacaggagaatcacaactccttctag
tggatccttcactcagaatgatagctggcgttga

DBGET integrated database retrieval system