KEGG   Moniliophthora perniciosa: MPER_11172Help
Entry
MPER_11172        CDS       T01089                                 

Definition
(GenBank) hypothetical protein
  KO
K00505  tyrosinase [EC:1.14.18.1]
Organism
mpr  Moniliophthora perniciosa
Pathway
mpr00350  Tyrosine metabolism
mpr01100  Metabolic pathways
mpr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    MPER_11172
Enzymes [BR:mpr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     MPER_11172
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tyrosinase
Motif
Other DBs
NCBI-ProteinID: EEB90597
UniProt: E2LVF4
AA seq 383 aa AA seqDB search
MEQVLQTAAVKIASTYTVNAEQFQAAAQNLRQPYWDWAANSTPPTQVISDDQVTIITSDG
SRKSVPNPLRRYTFNPIDRSFPRPYSLWRTTYRYPTSTTSQNPRENITALRNTLRSSQSQ
IRMQTYNLLTRVHTWPAFSNHTVGDGGSSSNSLEAIHDNIHVAVGANGHMSDPAVAAFDP
IFFLHHCQVDRLLSLWSALNPGVWVTPSTSENGTFTLRADTPIDRNTNLTPFWNTQSTYW
TSNNILDTASLGYTYPEFNNITTSSPGAVQTAIARIVNQLYGGPIGNTLPRPMRSQFANL
AAGAPAEKSQNGSALASSFVSLAAVNTNDNKAPAPVSNNGEAKQVPLGSDTRSRGFAPSE
GDGDDARAELSQAPTNWKFQMPF
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggagcaagttcttcagacggctgctgtcaaaattgcttccacttatactgtcaatgct
gaacagttccaagccgctgcccagaacttacgacagccctactgggactgggcggccaac
tcaacccctcccacacaagtgatttccgatgatcaagttactatcattactagcgatggt
tcaaggaaatcggtaccaaacccactccgtcgatacaccttcaatccaatcgacaggtct
ttcccaaggccatatagcttgtggaggactacatacaggtatccgaccagcacgacgagc
cagaatcccagggaaaacatcactgctctgagaaatacgctacggagctcgcagagtcag
atcagaatgcaaacgtataatctcctcacccgagttcacacttggcctgcgttcagcaac
cacactgttggtgacggaggcagctccagtaacagcttggaagctatacatgataatatt
catgtagcagttggcgctaacggacacatgtctgatcctgcagtggcagctttcgaccca
atcttcttcctccatcactgccaagttgatcggttactctccctttggtctgcgctgaac
cctggcgtttgggtaactccaagcacgtcggagaacggaaccttcaccttgcgcgctgat
actccaatagacagaaacaccaatctcacgcctttctggaacactcaatctacttattgg
acctcaaataacattctcgacaccgcaagtcttggatatacttatcccgaattcaataac
atcaccacaagcagtcccggtgcagtgcagactgccatcgccagaatcgtgaatcaactt
tacggcgggcctataggcaacaccctaccccgccccatgcgtagccagtttgccaacttg
gccgcaggagcgccggccgagaaatcccagaatggcagcgccttggcttcctcattcgtt
agccttgcagctgtaaacaccaatgacaacaaggcacccgcacctgtcagtaacaacgga
gaggctaagcaagtccctcttggctcggacacgagaagtagaggatttgcgccaagcgaa
ggtgatggcgatgatgctcgcgctgagctcagccaagcacctacgaattggaaatttcaa
atgccattt

DBGET integrated database retrieval system