KEGG   Moniliophthora perniciosa: MPER_11172Help
Entry
MPER_11172        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
mpr  Moniliophthora perniciosa
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    MPER_11172
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    MPER_11172
Enzymes [BR:mpr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     MPER_11172
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 383 aa AA seqDB search
MEQVLQTAAVKIASTYTVNAEQFQAAAQNLRQPYWDWAANSTPPTQVISDDQVTIITSDG
SRKSVPNPLRRYTFNPIDRSFPRPYSLWRTTYRYPTSTTSQNPRENITALRNTLRSSQSQ
IRMQTYNLLTRVHTWPAFSNHTVGDGGSSSNSLEAIHDNIHVAVGANGHMSDPAVAAFDP
IFFLHHCQVDRLLSLWSALNPGVWVTPSTSENGTFTLRADTPIDRNTNLTPFWNTQSTYW
TSNNILDTASLGYTYPEFNNITTSSPGAVQTAIARIVNQLYGGPIGNTLPRPMRSQFANL
AAGAPAEKSQNGSALASSFVSLAAVNTNDNKAPAPVSNNGEAKQVPLGSDTRSRGFAPSE
GDGDDARAELSQAPTNWKFQMPF
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggagcaagttcttcagacggctgctgtcaaaattgcttccacttatactgtcaatgct
gaacagttccaagccgctgcccagaacttacgacagccctactgggactgggcggccaac
tcaacccctcccacacaagtgatttccgatgatcaagttactatcattactagcgatggt
tcaaggaaatcggtaccaaacccactccgtcgatacaccttcaatccaatcgacaggtct
ttcccaaggccatatagcttgtggaggactacatacaggtatccgaccagcacgacgagc
cagaatcccagggaaaacatcactgctctgagaaatacgctacggagctcgcagagtcag
atcagaatgcaaacgtataatctcctcacccgagttcacacttggcctgcgttcagcaac
cacactgttggtgacggaggcagctccagtaacagcttggaagctatacatgataatatt
catgtagcagttggcgctaacggacacatgtctgatcctgcagtggcagctttcgaccca
atcttcttcctccatcactgccaagttgatcggttactctccctttggtctgcgctgaac
cctggcgtttgggtaactccaagcacgtcggagaacggaaccttcaccttgcgcgctgat
actccaatagacagaaacaccaatctcacgcctttctggaacactcaatctacttattgg
acctcaaataacattctcgacaccgcaagtcttggatatacttatcccgaattcaataac
atcaccacaagcagtcccggtgcagtgcagactgccatcgccagaatcgtgaatcaactt
tacggcgggcctataggcaacaccctaccccgccccatgcgtagccagtttgccaacttg
gccgcaggagcgccggccgagaaatcccagaatggcagcgccttggcttcctcattcgtt
agccttgcagctgtaaacaccaatgacaacaaggcacccgcacctgtcagtaacaacgga
gaggctaagcaagtccctcttggctcggacacgagaagtagaggatttgcgccaagcgaa
ggtgatggcgatgatgctcgcgctgagctcagccaagcacctacgaattggaaatttcaa
atgccattt

DBGET integrated database retrieval system