KEGG   Moniliophthora perniciosa: MPER_11198Help
Entry
MPER_11198        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
mpr  Moniliophthora perniciosa
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mpr00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 380 aa AA seqDB search
MITFSSTLSSKGLPTFIKSEDDLNTLMNTFQVVVKGLNLWQYYVLDTAREKDSIKAALSS
NRVTAWSGTDVAGKSVVELAEIAKSNGLIIGLGRLASRYGVRSDPNAAAGLVKAAFVSID
NIDALTDAWVRVVDVINVPLYQEWEEDTRVANDNVRNRIKYVRLDPNGPKLGEISKNLLR
REVIVWGDCVKLRYGSGPDDNPWLWEHMTSYVTSLAASFDGFRIDNCHSTPLEVGVWMLD
AARVVNPDLYVCAELFTGTEEMDLLFVKRLGINSLIRESYNGWDPKEYSRLLYRYGVGKP
IGSMDAACLTSIEEIPSPTGKGPVRKAIVTPLNGSMPHALLYDLTHDNESPMHKRSAEDA
LSTGALVTISHSATGSVKGL
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgatcactttctcaagcaccctttcctcaaaaggtcttcctaccttcatcaaatccgaa
gacgacttgaataccctgatgaacacgttccaagtcgtagttaaaggccttaatctgtgg
caatactacgttctggatactgctcgcgagaaggattctatcaaggcagcattgtcttct
aaccgtgttactgcatggagcgggacagatgttgcgggcaaatctgtggtcgagctcgct
gagatcgccaagtccaacgggctcatcatcggtttaggcaggctggcctcacgatatggc
gttcgttccgatcccaatgctgctgctgggcttgtgaaggcggcctttgtgagcattgat
aatatcgatgctctcactgatgcatgggtgagggtggttgatgttatcaatgtgccactt
taccaagagtgggaggaagatacgcgggttgccaacgataatgtaagaaacagaattaaa
tacgttcgcctcgacccgaacggccctaaactcggcgagatatctaagaacttacttcgt
cgagaggttattgtatggggcgactgcgtcaaactccgatatggatcaggccccgatgat
aatccatggctatgggagcatatgacttcctacgtcacgtctcttgcagccagttttgac
ggtttccgtatcgacaactgtcactctacaccactcgaagttggcgtgtggatgcttgac
gctgctcgcgtcgtcaatcctgatctctatgtctgtgccgaacttttcacaggaacagaa
gagatggaccttttgttcgtcaagcgtctgggtattaacagcttgatcagggagagctac
aatggatgggaccccaaggagtattcgaggctgttgtacagatacggtgtcggaaaaccg
atcggctcgatggacgccgcatgtctcactagcatcgaagaaattccttcacccaccgga
aaaggcccagtccgtaaagctattgtcacccccctcaacggctccatgcctcacgcattg
ttatatgatttgactcacgacaacgagtcgcctatgcacaagcgctcagcagaagatgcc
ctgtcgacgggtgctttggtcaccatcagtcattctgctactggttctgtcaaaggtttg

DBGET integrated database retrieval system