KEGG   Moniliophthora perniciosa: MPER_11413Help
Entry
MPER_11413        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mpr  Moniliophthora perniciosa
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MPER_11413
Enzymes [BR:mpr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     MPER_11413
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 214 aa AA seqDB search
GHPRIVTLGGDHTIVLPILRSLYKIYGPVSVIHFDAHLDTWPSYAGSTTDQSRITHGTFF
YLANEEGLMSNQSIHAGIRCKLGGVEDLETDENVGFQLISTDDIDDLGIPEIVRRIRSRI
GDTPVYLSLDIDVIAGTPEAGGWTTREVKRILRGLAGLNFVGADIVEVAPSYDNAEITGI
AAADLVHDFLSMLLSNEPPKSRRVDASTQFRDEL
NT seq 646 nt NT seq  +upstreamnt  +downstreamnt
cggtcatcctcgtattgttacccttggtggagatcacacaattgtcctccccattttgcg
atcgttgtacaaaatctatggtccagtatctgtgattcactttgatgcacatttggacac
ctggccttcatacgcaggttctaccaccgaccagtcacgtattactcatggcacgttctt
ctatcttgccaacgaagaaggtttgatgagtaaccaaagtattcatgccggaatcaggtg
taaacttgggggcgtcgaagacttggagaccgatgagaatgttggcttccagttgatctc
aacagatgatatagacgatctgggaatcccagagattgtgcgtcgaatccgaagcaggat
aggagacactccggtctatttgagcttagacattgacgtgatagctgggactccagaagc
gggagggtggaccactcgagaagttaaacgcattctcagaggattagccggtttaaattt
cgtaggcgccgacattgtagaggttgcaccctcatacgacaatgcggaaattactggcat
tgcagctgctgatttggttcatgattttctatcgatgttactgtcgaacgagcctccgaa
gagtcgtcgcgttgatgcttcaacccagttcagagacgagctgtga

DBGET integrated database retrieval system