KEGG   Moniliophthora perniciosa: MPER_11615Help
Entry
MPER_11615        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K04646  
clathrin heavy chain
Organism
mpr  Moniliophthora perniciosa
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    MPER_11615
Exosome [BR:mpr04147]
 Exosomal proteins
  Proteins found in most exosomes
   MPER_11615
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 639 aa AA seqDB search
MNLMHAPQVADAILGNEMFTHYDRPRIANLCEQAGLLQRALEHYEDLSDIKRVIVHATTL
PSDWLINYFSRLTKEQSMACLQEMLRVNMRQNLQVVVQIATKYSDILGPVTLIEMFEQYK
TFEGLYYYLGSIVNLSTDPEVHFKYIQAATRTGQIREVERICRESNYYSPEKVKNFLKEA
KLSDQLPLIIVCDRFDFVHDLVLYLYQNNLTNFIEVYVQRVNSVRTPQVVGGLLDVDCDE
STIKSLLASVPGNFPVDELVDEVEQRNRLKLILPWLEARVQAGSQDAAIYNAIAKIYIDS
NNNPEAFLKENNLYEPLVVGKFCAARDPSLAFIAYAKGLCDEELIALTNENSMFKQQARY
LVKRRQPELWAQVLVPDNMYRRQLIDQLVATALPECTDPDDVSVTVKAFLTADLPIELIE
LLEKIVIEPSPFSDNKNLQNLLLLTAVRADKGKVVGYINKLQNYDTGEIARIAIEHGLYE
EALTIYKKYEQHAEAINVLVEHIVSIDRGLDYANKVNKPEVWSRLAKAQLDGLRIKDSID
SYIKAEDPSNFAEVIEISSRAGKHDDLVRFLQMARKSLREPKIDTELAYAYAKTDRLHDM
EDFLGMTNVADILQVGEKCFEDELYQAAKLLFTSISNWA
NT seq 1918 nt NT seq  +upstreamnt  +downstreamnt
atgaaccttatgcatgctccccaagtcgctgatgctatccttggcaacgagatgttcact
cattatgatcgtcctcgtattgctaacttgtgtgagcaggcaggattgcttcagcgagcg
cttgagcactacgaagatctctcggatatcaaacgagttattgttcatgctaccaccctt
ccttctgactggctcatcaactactttagccgcttgacgaaggagcaatctatggcgtgc
ctgcaagagatgcttcgtgtaaatatgcgtcagaaccttcaggttgttgtccagattgcc
accaagtactccgacatcctaggccccgtgacattgattgaaatgttcgagcagtacaaa
acctttgagggtctctactactacctcggatccatcgtcaacctcagcactgatcccgag
gtacacttcaagtacatccaagcggctactcgaactggccagattagagaggtagagcgt
atctgtcgggagagcaactactacagcccggagaaagtcaaaaacttcctcaaggaggcc
aagctttcagatcagcttcctcttattatcgtctgcgaccgcttcgactttgtccacgat
ctcgtgctctatctctaccagaacaatctcaccaactttatcgaggtctatgtgcagcgc
gtcaactcggtgcggacgccccaagtcgttggaggccttttggatgtggactgcgacgaa
tccacaatcaagagcttgcttgcatctgttccaggcaacttccccgtcgatgagctggtt
gatgaggtcgagcagcgcaataggctgaaactcattcttccatggcttgaagcccgagtt
caggccggtagccaagacgccgcaatctacaatgccattgccaagatctacatcgacagc
aacaacaatcccgaggcgttcctgaaggagaataacttgtacgaacctttggttgtcgga
aagttctgcgcagctcgcgacccgtcactggcgttcattgcttatgccaaaggtctctgc
gacgaagaattaattgcattgaccaatgagaactcgatgttcaagcagcaagcaagatat
ctggtgaagcgcaggcaaccggagctttgggcgcaagtcctggtacccgacaatatgtac
cgcagacaactcattgatcagttggttgctactgctctccctgagtgcactgatcctgac
gatgtgtccgtgaccgtcaaggctttccttacagctgatcttcctattgagcttatcgag
cttcttgaaaaaatcgtcattgaaccgtctccgttcagtgataacaagaaccttcaaaac
ctacttctccttactgctgtccgggcagacaaaggaaaggttgtcggatatatcaacaaa
ctccagaactacgacactggcgagattgcccggattgccatcgagcatggcttgtatgag
gaggcgttaacgatctacaagaaatatgagcaacacgctgaggctatcaatgtcctcgtt
gagcacattgtgtcaatcgatcgtggtctggactatgccaacaaggtcaacaagcccgag
gtttggagtcgacttgccaaagcacagttggacggccttcgtatcaaagactcgatagac
tcgtacatcaaggctgaagatccgtccaactttgctgaggttatcgagatctcaagtcgc
gccggcaagcacgatgatctcgttcgtttcctccagatggctcggaaatccctacgcgag
cctaagattgacacggagttggcatacgcctatgccaagaccgaccgcctccatgatatg
gaggacttcttaggcatgacgaatgtcgcagatatcctgcaagttggagagaagtgcttc
gaggatgaattgtaccaagctgcgaaactgctcttcacaagtatttcgaattgggctc

DBGET integrated database retrieval system