KEGG   Moniliophthora perniciosa: MPER_12207Help
Entry
MPER_12207        CDS       T01089                                 

Definition
(GenBank) hypothetical protein
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mpr  Moniliophthora perniciosa
Pathway
mpr00010  Glycolysis / Gluconeogenesis
mpr00620  Pyruvate metabolism
mpr00640  Propanoate metabolism
mpr00680  Methane metabolism
mpr01100  Metabolic pathways
mpr01110  Biosynthesis of secondary metabolites
mpr01130  Biosynthesis of antibiotics
mpr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MPER_12207
   00620 Pyruvate metabolism
    MPER_12207
   00640 Propanoate metabolism
    MPER_12207
  Energy metabolism
   00680 Methane metabolism
    MPER_12207
Enzymes [BR:mpr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MPER_12207
Lipid biosynthesis proteins [BR:mpr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MPER_12207
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: EEB89671
UniProt: E2LY30
AA seq 415 aa AA seqDB search
VPAYCPCESVKSEDPLFILYTSGSTGKPKGVVHTTGGYLLGAALTVKYVFDVHPGDKFAC
MADIGWITGHTYIVYGPLLNGVSTTLFESTPVYPTPSRYWETVAKHKLTHFYSAPTAIRL
LRRLGHQHVEGHDLSSIRVLGSVGEPINPEAWNWYNEYVGKKQCAIVDTFWQTETGSIVI
TPFPGAIETKPGSATVPFLGIQPVLLDPVSGKELDGPGVEGVLAMKAPWPSIARTIWGDH
ARYLDVYMKPYPGYYFTGDGAARDEDGYIWIRGRVDDVINVSGHRLSTAEIESALIMHKG
VAETAVIGTADELTGQAVYAFVTLKPEFKYDPAHEESLTKELVLQVRKVIGPFAAPKKVF
IVGDLPKTRSGKIMRRIMRKIVAGEGDQLGDLSTVAEPGVVDVIKNKVQEAMGGK
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
gtccctgcatactgcccatgcgaatcggtgaaatcggaagatccattgttcatcctatac
acttccggttcgacaggtaaacccaagggtgtcgtacacactaccggcgggtaccttctc
ggtgccgctttgactgtcaaatacgtattcgacgttcaccccggcgacaaattcgcatgt
atggccgacattggttggatcacaggtcacacttatatcgtatacggtcctctcctcaac
ggcgtctccacgaccctctttgaatccacacccgtctatcccacaccctctcgctattgg
gaaaccgtagccaaacacaaacttacccatttctattccgctcctacggctataaggtta
ttgaggaggctgggacatcaacatgtcgaaggacatgatctttcgtcgattcgggtactt
ggatcggtgggcgaaccgattaatcctgaagcttggaattggtataatgagtatgtgggg
aagaagcagtgtgcgattgtggatactttttggcaaacagaaaccggctccatcgttatc
acacctttcccaggagccatcgaaaccaaaccgggaagtgccactgtcccattcctaggt
atccaacctgttcttcttgatcctgtatcgggtaaagaactggatggaccgggtgtagag
ggtgttttggcgatgaaggcaccttggccgtctattgcgaggacgatttggggagatcat
gcgaggtatttggatgtttatatgaagccgtacccaggatattactttacgggagatggt
gctgcacgcgatgaagatgggtatatatggattagaggtcgtgttgatgatgttatcaac
gttagtggacatcgtctatccacagctgaaatcgaatctgcactcatcatgcacaaaggt
gtagccgaaacagccgtgatcgggactgcagatgagttgacgggtcaagctgtttatgcg
tttgttactttgaaaccggaattcaaatatgacccagcacatgaagaatccttaaccaaa
gaactggtattacaagtccgaaaagtgattggaccgtttgcggcaccgaaaaaagtgttt
attgtgggtgatttaccaaagacgaggagtggaaagatcatgcgtcgcatcatgcgtaaa
atcgtagcaggcgaaggagatcaactaggtgatttatcaactgtagcagaaccgggtgtg
gtggatgtgatcaagaataaggtgcaggaggctatgggggggaagtaa

DBGET integrated database retrieval system