KEGG   Moniliophthora perniciosa: MPER_12255Help
Entry
MPER_12255        CDS       T01089                                 

Definition
(GenBank) hypothetical protein
  KO
K03505  DNA polymerase delta subunit 4
Organism
mpr  Moniliophthora perniciosa
Pathway
mpr00230  Purine metabolism
mpr00240  Pyrimidine metabolism
mpr01100  Metabolic pathways
mpr03030  DNA replication
mpr03410  Base excision repair
mpr03420  Nucleotide excision repair
mpr03430  Mismatch repair
mpr03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MPER_12255
   00240 Pyrimidine metabolism
    MPER_12255
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    MPER_12255
   03410 Base excision repair
    MPER_12255
   03420 Nucleotide excision repair
    MPER_12255
   03430 Mismatch repair
    MPER_12255
   03440 Homologous recombination
    MPER_12255
DNA replication proteins [BR:mpr03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    MPER_12255
DNA repair and recombination proteins [BR:mpr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      MPER_12255
   MMR (mismatch exicision repair)
    DNA polymerase delta complex
     MPER_12255
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_delta_4
Motif
Other DBs
NCBI-ProteinID: EEB89626
UniProt: E2LY75
AA seq 176 aa AA seqDB search
MKQTRLSFTSMKRTDSKGKLGTSTRSPETIVIKDSPSSDSEVEQDVRQKRKNRKSVPETK
EKGLEDIKPTVLDEEPPRPELKVKDSRWNGVSAAARAKMNNLSPIHAEGKNRIHHILNVF
DMSYEYGPCIGLTRLERWDRANTMGLNPPVEIRDILLTRQGIEDTDYAQCSLYDRV
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaaccaggctctcctttacgtctatgaagcgaaccgactccaaggggaaatta
ggaacttccacccggagtcctgaaactatcgtcatcaaggattcaccttcatccgactcg
gaagttgagcaggacgttcgtcaaaagaggaagaataggaagagtgtcccagaaacgaaa
gagaaaggtctcgaagacatcaagccaactgtccttgatgaagaaccacctcgtccggaa
ctgaaggtcaaggactcgaggtggaatggtgtttctgccgctgcacgggcgaaaatgaac
aatctatctcccattcatgcggagggaaagaacaggatccaccacatcctcaatgtcttt
gatatgtcctatgaatacggaccgtgcattggtctgacacgcctcgagcgctgggatagg
gccaatacgatgggactcaatcccccggttgagattcgtgatattttgctcacccggcaa
ggtattgaagataccgactacgcacaatgctcgctctatgaccgagtttaa

DBGET integrated database retrieval system