KEGG   Moniliophthora perniciosa: MPER_12255Help
Entry
MPER_12255        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
mpr  Moniliophthora perniciosa
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:mpr00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mpr00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:mpr03030]
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mpr03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:mpr03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:mpr03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mpr03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 176 aa AA seqDB search
MKQTRLSFTSMKRTDSKGKLGTSTRSPETIVIKDSPSSDSEVEQDVRQKRKNRKSVPETK
EKGLEDIKPTVLDEEPPRPELKVKDSRWNGVSAAARAKMNNLSPIHAEGKNRIHHILNVF
DMSYEYGPCIGLTRLERWDRANTMGLNPPVEIRDILLTRQGIEDTDYAQCSLYDRV
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaaccaggctctcctttacgtctatgaagcgaaccgactccaaggggaaatta
ggaacttccacccggagtcctgaaactatcgtcatcaaggattcaccttcatccgactcg
gaagttgagcaggacgttcgtcaaaagaggaagaataggaagagtgtcccagaaacgaaa
gagaaaggtctcgaagacatcaagccaactgtccttgatgaagaaccacctcgtccggaa
ctgaaggtcaaggactcgaggtggaatggtgtttctgccgctgcacgggcgaaaatgaac
aatctatctcccattcatgcggagggaaagaacaggatccaccacatcctcaatgtcttt
gatatgtcctatgaatacggaccgtgcattggtctgacacgcctcgagcgctgggatagg
gccaatacgatgggactcaatcccccggttgagattcgtgatattttgctcacccggcaa
ggtattgaagataccgactacgcacaatgctcgctctatgaccgagtttaa

DBGET integrated database retrieval system