KEGG   Moniliophthora perniciosa: MPER_12291Help
Entry
MPER_12291        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
mpr  Moniliophthora perniciosa
Brite
Enzymes [BR:mpr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     MPER_12291
Peptidases [BR:mpr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   MPER_12291
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 640 aa AA seqDB search
MSHPPVDKTPETSMVGGLETLLMMIENALWKSEQRALRVNSQSFQRKIGWSDSVRRIFGC
LGFIPDTNDKEPVVRAPPCDNSTVLGRNNRAKLLRAWVEIGAWTSHFKKTNDAIIKLREN
TPHKLWVTVDPVREMYQTAIGAHHVQKRQFLEISLSFAYLAQCRCDPARTMEYFTAFSTI
VKIMEQVASCPTELQELMMMEQSRQRFTVEELQSAAETLGFGPNGALRVDYDNEIEDEFI
ENAWKECIKRSWTEADPRALQRAANDALRIVAEAKGSVGLKTLYDKGNNSLMLTPERAYD
VLEVPRDIDETMLITIFGMRVEEQPSQIERMQEALNVIAEVRSSERLREFIRTSRDPGEA
ITYFYTIKDLREAVIPLGKVDLKSIEEEKFSDDALTKHRVGGRLVTRREVQRSRKFVNHL
AELFRNLEHSQATAVTPAIELAKLALVTSKDEEEDEVDQGGTDASNDTDATLVEDGPSRF
SIEPERQTSPPPQSPGPSPGSVLGKRARRASEMDIDIALAPQESAGSPSAQSMSRANSLP
QPHTDSSKLGESSTPVLSVKDVELQDVEMNDASQSAKKVPPPLPPRKTPVKNDSVMMFGR
QHDVAECMDNCMFQIETAMLKFDEVVDTPDEEDTNSIVKQ
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgtcacacccgccagtcgacaagacgcctgaaaccagtatggttggaggcttggaaacg
ctcttgatgatgatagagaacgccctatggaaatccgaacagcgtgcactccgtgttaac
agtcaaagctttcagagaaaaataggatggagtgactctgtccgacggatatttggttgc
cttggcttcattccagacacaaacgataaagagcccgtcgttcgtgcgccaccatgcgat
aattctacggttctcggtagaaacaatcgtgccaaactgctgcgtgcttgggttgagatc
ggtgcgtggacgtcacatttcaagaagacgaacgacgccatcataaagttaagggagaac
acaccccataagttgtgggttactgttgatcctgtcagagagatgtaccagaccgccatc
ggtgcccatcatgttcagaagcgacagtttctcgagatatccttatccttcgcatatttg
gcccagtgtcgttgtgatcccgctcggacaatggaatacttcaccgcattctccaccatt
gtcaagatcatggaacaggtggccagttgtcccactgaacttcaggaactcatgatgatg
gaacaatctcgtcaacggttcacagttgaggagctccagagtgcagcggagacactcggt
ttcgggccgaatggcgctctgagggtcgattatgacaatgagattgaagacgagtttatt
gagaacgcttggaaggaatgtatcaagcgatcatggaccgaagctgatccccgagcgctg
caaagagccgcaaatgacgcccttcggatcgttgctgaagccaaaggaagtgtgggactc
aaaacactatatgataaagggaataacagtctgatgctgactccggaaagagcatatgat
gtgctggaggtccccagggacattgacgaaaccatgctgatcactatttttggtatgagg
gtggaggaacagccttcccagatagaaaggatgcaagaggcccttaatgtcatcgcagaa
gttcgtagcagcgaacgattgcgggagtttattagaacgtcccgagaccctggagaggcc
attacgtatttctataccatcaaagacctccgagaggcagtaatacccctaggaaaggtg
gatttgaaatccattgaagaagaaaagttctcggatgatgcattgactaaacatcgtgtt
ggtggtcgccttgtaacacgtcgcgaagttcaacgatcaagaaaatttgtcaatcatttg
gcggaacttttccggaacctcgagcacagccaggccactgctgtcacacctgccatcgag
ctagccaagttggcactcgtcacgtcaaaggatgaagaagaggatgaggtcgaccaaggg
ggaaccgatgcatcaaatgatacagacgccactttagtcgaggatggtccatccagattc
tcaatcgaaccagaacgacaaacttctcccccgcctcaatcgcctggaccttcgcctggc
tccgtcctaggcaaaagagcccggcgagctagtgaaatggacattgatatcgcgttggct
cctcaggagagcgcgggttcgccatctgcccagtcaatgtctcgagccaactcactccca
caacctcataccgattcgtccaagcttggggaaagctcaacaccagtgctcagtgttaag
gatgtcgaacttcaagatgtagagatgaacgatgcctctcaatctgccaagaaagtcccg
ccgcctcttccgccccgtaagacgcctgtaaagaatgactcagttatgatgttcggacgg
caacacgatgttgccgaatgtatggacaattgcatgttccaaatcgagacggcgatgctc
aagtttgacgaggtggttgatactccagatgaagaggatacgaacagcatcgtcaaacag
tga

DBGET integrated database retrieval system