KEGG   Moniliophthora perniciosa: MPER_12453Help
Entry
MPER_12453        CDS       T01089                                 

Definition
(GenBank) hypothetical protein
  KO
K01181  endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
mpr  Moniliophthora perniciosa
Brite
Enzymes [BR:mpr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     MPER_12453
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_11
Motif
Other DBs
NCBI-ProteinID: EEB89445
UniProt: E2LYQ6
AA seq 211 aa AA seqDB search
MKYYSIATPVNVTEDSGEVLQPSSTGVSNGYFYSWFAVGTNSATYTNGPGGQYTVTWSGN
VGDIVGGKGWNPGSSTRIIHYSGTYQPNGNSYFAVYGWTRNALIEYYIVESYGSYDPRGN
AVKKGTVTCDGASYDVLSAWRYNEPSIDGIQTFQQFWSVRGPKKPNGSISGSVNVACHFH
AWKKFGMTPGLGVPTARLGSARLGSLAAKTV
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaaatactacagtatcgccactcccgtcaacgtcacggaagactccggagaggtcttg
cagcctagctccactggcgtgtccaacggctatttctactcttggttcgccgtaggcact
aattctgccacatacaccaacggacccggtggccagtacactgtaacctggtccgggaac
gtgggggacatcgttggtggtaagggatggaacccaggaagttccacacgaatcatccat
tacagcggtacataccaacccaatggtaacagttacttcgctgtctacggctggactcgc
aacgctctcatcgagtactacatcgtcgaatcgtacggttcctacgaccctcggggtaat
gctgtgaaaaagggtacagtgacctgcgacggtgcctcatacgatgttctctcggcgtgg
cgttacaacgagccctccatcgatggtatccagacattccagcaattctggagtgtgaga
ggcccaaagaaacctaacggaagcattagcggttctgttaacgttgcgtgccactttcac
gcatggaagaaatttggaatgacacctggtttaggggtgccaacagctcggctcggctcg
gctcggctcggctctttagccgctaaaaccgtttag

DBGET integrated database retrieval system