KEGG   Moniliophthora perniciosa: MPER_12605Help
Entry
MPER_12605        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mpr  Moniliophthora perniciosa
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MPER_12605
Enzymes [BR:mpr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     MPER_12605
Peptidases [BR:mpr01002]
 Cysteine Peptidases
  Family C44
   MPER_12605
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 399 aa AA seqDB search
MCGITVVRSISSSAIQPSFDKLAKQLKASIATINHRGPDSSGIYVSNDNRLGIGHARLSI
IDLESGQQPLHDKDQLVHAVVNGEFYDYDRIREDLVQRGCHFQSRVDSELVIHLYKVYGQ
NFIHHLRGDSLFDGKLMIASEMKAFVPLGWKPEWDIESIVQMGDYNDNRTVFKGVRREDV
DEGPIAKRMAESIGATVHMVMPTEEDLVCAFQKVVYHAEQPVASFHGARKLILSEHYRRH
GYKVTLSGEGSDESFGGYAFLAPDFLRARDFTADALDIKQPDDAERVAALAEYETGHPPQ
DHASLAEMSLSDSQVGRSMLGGISTHRNFASLGLDDSIFSAAALNQVPLRDRCLTVAEGL
SPVARDKMSSGQWHPLHSALYAWTKTGLTNHLLNSIGDR
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggcatcaccgttgtgaggtccatctcctccagtgctattcaaccctcgttcgac
aagctcgcaaagcaactcaaggcttctattgccacaatcaatcacagaggtccggattct
tcaggcatctatgtctcaaatgataatcgccttggcatcgggcatgctcgactgtctatc
attgacctcgagagtgggcagcaaccgctgcacgacaaggatcagctcgtccacgctgta
gtcaatggtgaattctacgactacgatcgtatcagggaagatttggtgcaaagaggatgc
catttccaatcccgtgtcgattcagaactggtcattcatctatataaagtatatggccaa
aactttatccatcaccttcgtggagattcgctgttcgacggaaagctcatgattgcgagt
gagatgaaagcatttgttcccttggggtggaaaccagaatgggatatagagagtattgtg
caaatgggcgactacaacgataacagaactgtctttaaaggcgtccgaagggaagatgta
gacgagggtccgattgcgaagcgtatggcggaatctattggcgcgacagttcatatggtg
atgccaaccgaggaggatttggtttgtgcattccagaaggttgtgtaccatgcggagcag
cctgtcgcaagttttcatggtgcaaggaagcttatcctctcagagcattatcgtcgacat
ggctataaagttacattgtctggggaaggatctgacgagagtttcggtggttatgccttc
ctcgcgccagatttccttcgtgcgagagacttcacagccgatgctctagacatcaaacag
ccagatgatgcggaacgtgttgctgctctagccgaatatgagacgggacatcctcctcag
gaccacgcttcccttgccgaaatgtcgctctctgatagtcaggttggacgctccatgcta
ggagggatcagcactcacagaaattttgcatcgttgggattggatgattccatattcagt
gccgctgccttgaaccaagttccgcttcgcgaccgctgcctcacagtcgcggagggttta
tctccggtagcaagggacaaaatgagttccggtcagtggcatccgctacattctgcattg
tacgcatggaccaagactggacttaccaatcaccttctgaatagcatcggcgaccgttaa

DBGET integrated database retrieval system