KEGG   Moniliophthora perniciosa: MPER_12636Help
Entry
MPER_12636        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K11870  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.1.2.15]
Organism
mpr  Moniliophthora perniciosa
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 400 aa AA seqDB search
MVLESLGLVLPWNWGHSSGSTTGVTHHEKRRNRKKASKASEGVELSSIHGHGDGYYPGLV
NISGTYCFMNSTVQVCKIQYLEDTIHEKAELFDVPTPVIDTLRDLLHPDLITVLSSRSGL
NSLINSREHQDAQELFQLLSECIKSEITAIDKEQARDRGLGGLAQATEHNREIGKSVFDG
LTAHRRSCVVCGYTEAVMHFPFDNWQLAVPRMASTCLLEDCLSDYTRLEVLKDCICRKCS
LNATHRRLIGEVETLSQAQNPTPSKKKRLKEVKKMEVKVRAALEQGRIEDELEGPKMPYL
GRYIDSARRKPKSGVAESERWKSPKLVIETALPDPSAVGGPDGNEESAEGFEDYVWEDSD
PETAPGSGRGWLRVSDDSVTECGIESVLQEGSGAFMLYYE
NT seq 1201 nt NT seq  +upstreamnt  +downstreamnt
atggttcttgagagcctcggcctcgttctgccatggaactggggacatagctctggaagc
accaccggcgttacccatcatgagaagagaagaaatagaaaaaaggccagtaaagcttca
gagggagtagaactttcttcaatacatggacacggggatggctattatcctggtcttgta
aacatctctgggacgtattgcttcatgaattcgaccgtacaggtatgcaaaattcagtat
ctggaagacacaatacatgaaaaagccgagcttttcgatgtcccaacacccgttattgat
acccttagagatctcctgcacccagatcttattacggtcctgtcctcgaggtcgggtttg
aattccctcataaactcgcgggagcaccaggatgcccaggaattgttccagctactctct
gaatgtataaagtcggaaataaccgctattgacaaggaacaggctcgagatcgaggtctg
ggcggtttagcgcaagctacagagcacaacagagaaattgggaaaagcgtctttgatggc
ctcacagcacatagacggagctgtgttgtctgcggatacaccgaggctgtcatgcatttc
ccgtttgacaattggcaattggcggtccctcgcatggcgtcaacttgcttattggaggat
tgcctctcggattacacgaggctagaggttctcaaggattgcatttgtcgcaagtgctct
ctgaacgcaacccatcggcgcttaataggagaggtggaaacgctttcgcaagcccaaaac
cctacaccttcaaagaagaagcggctaaaggaggtcaagaaaatggaagtcaaggtcagg
gccgctcttgaacagggcagaattgaagatgagttggaggggccgaagatgccttatctc
ggacgatatatcgactcagcgcgaaggaagccaaaatctggcgttgcggagagcgaacgc
tggaagtcgcccaaactggtcatagagacggctcttccagatccatctgcggtcggtggt
ccagacggcaatgaggagagcgcagaaggctttgaggactatgtctgggaggattccgat
ccggagactgcaccaggatcaggtcgaggatggcttcgagtctcggacgactccgtgact
gaatgtgggatcgagagtgttttgcaggaaggctccggagctttcatgctctactacgag
c

DBGET integrated database retrieval system