KEGG   Moniliophthora perniciosa: MPER_12636Help
Entry
MPER_12636        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K11870  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.4.19.12]
Organism
mpr  Moniliophthora perniciosa
Brite
Enzymes [BR:mpr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     MPER_12636
Peptidases [BR:mpr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   MPER_12636
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 400 aa AA seqDB search
MVLESLGLVLPWNWGHSSGSTTGVTHHEKRRNRKKASKASEGVELSSIHGHGDGYYPGLV
NISGTYCFMNSTVQVCKIQYLEDTIHEKAELFDVPTPVIDTLRDLLHPDLITVLSSRSGL
NSLINSREHQDAQELFQLLSECIKSEITAIDKEQARDRGLGGLAQATEHNREIGKSVFDG
LTAHRRSCVVCGYTEAVMHFPFDNWQLAVPRMASTCLLEDCLSDYTRLEVLKDCICRKCS
LNATHRRLIGEVETLSQAQNPTPSKKKRLKEVKKMEVKVRAALEQGRIEDELEGPKMPYL
GRYIDSARRKPKSGVAESERWKSPKLVIETALPDPSAVGGPDGNEESAEGFEDYVWEDSD
PETAPGSGRGWLRVSDDSVTECGIESVLQEGSGAFMLYYE
NT seq 1201 nt NT seq  +upstreamnt  +downstreamnt
atggttcttgagagcctcggcctcgttctgccatggaactggggacatagctctggaagc
accaccggcgttacccatcatgagaagagaagaaatagaaaaaaggccagtaaagcttca
gagggagtagaactttcttcaatacatggacacggggatggctattatcctggtcttgta
aacatctctgggacgtattgcttcatgaattcgaccgtacaggtatgcaaaattcagtat
ctggaagacacaatacatgaaaaagccgagcttttcgatgtcccaacacccgttattgat
acccttagagatctcctgcacccagatcttattacggtcctgtcctcgaggtcgggtttg
aattccctcataaactcgcgggagcaccaggatgcccaggaattgttccagctactctct
gaatgtataaagtcggaaataaccgctattgacaaggaacaggctcgagatcgaggtctg
ggcggtttagcgcaagctacagagcacaacagagaaattgggaaaagcgtctttgatggc
ctcacagcacatagacggagctgtgttgtctgcggatacaccgaggctgtcatgcatttc
ccgtttgacaattggcaattggcggtccctcgcatggcgtcaacttgcttattggaggat
tgcctctcggattacacgaggctagaggttctcaaggattgcatttgtcgcaagtgctct
ctgaacgcaacccatcggcgcttaataggagaggtggaaacgctttcgcaagcccaaaac
cctacaccttcaaagaagaagcggctaaaggaggtcaagaaaatggaagtcaaggtcagg
gccgctcttgaacagggcagaattgaagatgagttggaggggccgaagatgccttatctc
ggacgatatatcgactcagcgcgaaggaagccaaaatctggcgttgcggagagcgaacgc
tggaagtcgcccaaactggtcatagagacggctcttccagatccatctgcggtcggtggt
ccagacggcaatgaggagagcgcagaaggctttgaggactatgtctgggaggattccgat
ccggagactgcaccaggatcaggtcgaggatggcttcgagtctcggacgactccgtgact
gaatgtgggatcgagagtgttttgcaggaaggctccggagctttcatgctctactacgag
c

DBGET integrated database retrieval system