KEGG   Moniliophthora perniciosa: MPER_12660Help
Entry
MPER_12660        CDS       T01089                                 

Definition
(GenBank) hypothetical protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mpr  Moniliophthora perniciosa
Pathway
mpr00010  Glycolysis / Gluconeogenesis
mpr00020  Citrate cycle (TCA cycle)
mpr00620  Pyruvate metabolism
mpr01100  Metabolic pathways
mpr01110  Biosynthesis of secondary metabolites
mpr01130  Biosynthesis of antibiotics
mpr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MPER_12660
   00020 Citrate cycle (TCA cycle)
    MPER_12660
   00620 Pyruvate metabolism
    MPER_12660
Enzymes [BR:mpr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MPER_12660
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Biotin_lipoyl 2-oxoacid_dh E3_binding
Motif
Other DBs
NCBI-ProteinID: EEB89262
UniProt: E2LZ89
AA seq 294 aa AA seqDB search
MESGTECPNGRHALSQFNMPAMSPTMTEGGIAVWKKKEGENFSAGEVLLEIETDKATIDV
EAQDDGVMAKIIGPDGTKNVKIGQPIAIVGEEGGEKEDKAASAPKAEPETPKSSPPQEFK
EDSKPDLPIGNRIFASPIAKKIALGRGIPLSKVKGSGPNGRILREDVDKYKPAAEAATST
ASQPAAAQLPDYVDTPISNMCSTIGSRLTQSKQEHPHYYVTVDINMDNVLKLREVFSKGL
DEKEPKAKLSVNDFIVKAVGCALSDVPEANSAWLGDVIRTVSLPHTPRPGHSKF
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggaatcgggaacagagtgccccaacggaaggcatgcactctcccaattcaacatgcct
gctatgagtcctacgatgacggagggtggcattgctgtctggaaaaagaaagagggcgaa
aacttctctgcaggagaagttcttttggagattgaaaccgacaaggcaaccattgacgtt
gaagctcaggacgacggtgtaatggcaaaaattatcggaccagacggtacgaaaaacgtg
aaaattggccaacctattgctatcgtcggagaagagggaggagagaaggaggacaaggca
gcatccgcccccaaggcagagcctgaaacccccaagtcatcacctccacaggaattcaag
gaagactccaagcctgaccttcctattggcaaccgtattttcgcgtcacctatagccaaa
aagattgctttgggacgcggcatccctctcagcaaggtcaagggctcaggtcctaatggc
cggattctccgtgaagacgtcgacaagtacaagcccgctgccgaagctgctacctctacc
gcatcacaacctgcagctgctcaattacctgactatgtcgacaccccgatctccaacatg
tgtagcaccattggctctcgtctcacgcagtcgaaacaagagcatcctcactactacgtc
actgtcgatatcaacatggacaatgttttgaaacttcgcgaggtcttcagcaagggtttg
gatgagaaggaacctaaggccaagctcagcgtaaacgacttcattgtgaaggccgttgga
tgcgcattgtcagatgttccagaggcaaactcggcgtggttaggcgatgttattcggacg
gttagccttcctcatactcctcggcctggtcattctaaattctga

DBGET integrated database retrieval system