KEGG   Moniliophthora perniciosa: MPER_12725Help
Entry
MPER_12725        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
mpr  Moniliophthora perniciosa
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MPER_12725
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MPER_12725
   00630 Glyoxylate and dicarboxylate metabolism
    MPER_12725
Enzymes [BR:mpr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     MPER_12725
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 198 aa AA seqDB search
MIPGIKIHSKVAQKAQDEILTDDALKFLAALHRTFESTRQSLLVAREDAQRRWDTGAPFD
FPAETAHIRSDPSWQCAPPAPGLEDRRVEITGPTDRKMVVNALNSGAKTFMADFEDSSAP
SFANMVNGQLNLRDAVRRQIDFEAGGKSYKLTENPAVLIVRPRGWQLDEPRVTVDNVPEL
SGTVSSDPSGLPLEEFFS
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgattccaggcatcaaaattcactccaaagtcgcccaaaaggcccaggacgagatcctt
acagacgatgccctcaaattcctcgctgctcttcatcgtacctttgaatccactaggcaa
tctctacttgtcgccagagaggacgcgcagcgtcgctgggacactggagcaccattcgac
tttcccgcagagacagctcacattcgctctgacccatcatggcaatgcgcaccacccgct
cctggcctcgaggacagacgagtcgaaattacgggtccgactgaccgaaagatggtcgtc
aacgcgttgaatagcggtgccaagaccttcatggcggactttgaagattcgagtgcccca
tcgttcgccaacatggtcaacggtcagctcaaccttcgtgatgccgttcgtcgccaaatc
gatttcgaagctggaggaaagagctataaattgacagagaaccctgctgtgcttatcgtc
cgccctcgtggatggcaacttgatgaaccacgcgttacggttgacaatgtaccggaatta
tcgggcactgtctcatcagacccttcggggcttcccctggaggaatttttcagctaa

DBGET integrated database retrieval system