KEGG   Moniliophthora perniciosa: MPER_12725Help
Entry
MPER_12725        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
mpr  Moniliophthora perniciosa
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:mpr01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mpr00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:mpr00630]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 198 aa AA seqDB search
MIPGIKIHSKVAQKAQDEILTDDALKFLAALHRTFESTRQSLLVAREDAQRRWDTGAPFD
FPAETAHIRSDPSWQCAPPAPGLEDRRVEITGPTDRKMVVNALNSGAKTFMADFEDSSAP
SFANMVNGQLNLRDAVRRQIDFEAGGKSYKLTENPAVLIVRPRGWQLDEPRVTVDNVPEL
SGTVSSDPSGLPLEEFFS
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgattccaggcatcaaaattcactccaaagtcgcccaaaaggcccaggacgagatcctt
acagacgatgccctcaaattcctcgctgctcttcatcgtacctttgaatccactaggcaa
tctctacttgtcgccagagaggacgcgcagcgtcgctgggacactggagcaccattcgac
tttcccgcagagacagctcacattcgctctgacccatcatggcaatgcgcaccacccgct
cctggcctcgaggacagacgagtcgaaattacgggtccgactgaccgaaagatggtcgtc
aacgcgttgaatagcggtgccaagaccttcatggcggactttgaagattcgagtgcccca
tcgttcgccaacatggtcaacggtcagctcaaccttcgtgatgccgttcgtcgccaaatc
gatttcgaagctggaggaaagagctataaattgacagagaaccctgctgtgcttatcgtc
cgccctcgtggatggcaacttgatgaaccacgcgttacggttgacaatgtaccggaatta
tcgggcactgtctcatcagacccttcggggcttcccctggaggaatttttcagctaa

DBGET integrated database retrieval system