KEGG   Moniliophthora perniciosa: MPER_12725Help
Entry
MPER_12725        CDS       T01089                                 

Definition
(GenBank) hypothetical protein
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
mpr  Moniliophthora perniciosa
Pathway
mpr00620  Pyruvate metabolism
mpr00630  Glyoxylate and dicarboxylate metabolism
mpr01100  Metabolic pathways
mpr01110  Biosynthesis of secondary metabolites
mpr01200  Carbon metabolism
Module
mpr_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MPER_12725
   00630 Glyoxylate and dicarboxylate metabolism
    MPER_12725
Enzymes [BR:mpr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     MPER_12725
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: EEB89203
UniProt: E2LZE9
AA seq 198 aa AA seqDB search
MIPGIKIHSKVAQKAQDEILTDDALKFLAALHRTFESTRQSLLVAREDAQRRWDTGAPFD
FPAETAHIRSDPSWQCAPPAPGLEDRRVEITGPTDRKMVVNALNSGAKTFMADFEDSSAP
SFANMVNGQLNLRDAVRRQIDFEAGGKSYKLTENPAVLIVRPRGWQLDEPRVTVDNVPEL
SGTVSSDPSGLPLEEFFS
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgattccaggcatcaaaattcactccaaagtcgcccaaaaggcccaggacgagatcctt
acagacgatgccctcaaattcctcgctgctcttcatcgtacctttgaatccactaggcaa
tctctacttgtcgccagagaggacgcgcagcgtcgctgggacactggagcaccattcgac
tttcccgcagagacagctcacattcgctctgacccatcatggcaatgcgcaccacccgct
cctggcctcgaggacagacgagtcgaaattacgggtccgactgaccgaaagatggtcgtc
aacgcgttgaatagcggtgccaagaccttcatggcggactttgaagattcgagtgcccca
tcgttcgccaacatggtcaacggtcagctcaaccttcgtgatgccgttcgtcgccaaatc
gatttcgaagctggaggaaagagctataaattgacagagaaccctgctgtgcttatcgtc
cgccctcgtggatggcaacttgatgaaccacgcgttacggttgacaatgtaccggaatta
tcgggcactgtctcatcagacccttcggggcttcccctggaggaatttttcagctaa

DBGET integrated database retrieval system