KEGG   Moniliophthora perniciosa: MPER_12747Help
Entry
MPER_12747        CDS       T01089                                 

Definition
(GenBank) hypothetical protein
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
mpr  Moniliophthora perniciosa
Pathway
mpr00860  Porphyrin and chlorophyll metabolism
mpr01100  Metabolic pathways
mpr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MPER_12747
Enzymes [BR:mpr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     MPER_12747
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     MPER_12747
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox_2 NAD_binding_9 Thi4 FAD_oxidored MCRA
Motif
Other DBs
NCBI-ProteinID: EEB89183
UniProt: E2LZG9
AA seq 479 aa AA seqDB search
MSRQIAVLGGGLTGLSSAFHLSRRFPEASITLLEKGPHLGGWVSSERVSVTHPEGHTAEV
ILETGPRTLRPNAKSVLELIHLLGLRNLLKTTPTTASAAKLRYLQIPESQELVSIPTSVL
SSLSSPLRPILVPYVLKEPMKRANRPAGLTDESLDSFMSRTFGSALVHGIYAADSRKLSV
RAAFPSLWDAEERGWGSVVRGFLVPTKHKSSQADSDYELGDILQLMNRVSVFTFRDGIST
ITNGLVDHLKQRPNVKLLANAGAEKLELADGKILLTTSNNNIMKPTHVVSALPLHILHSI
LSDKEALPHLTANPFSSITVINLVFPLDPKKPRLHPPGFGYLIPRPVTGYGPTDAGILGT
VFDSYEKYFANMTVMAGGPYPTMPDLDAVLKHLSTHLAEGETDSYSAKELPQPILVRTTH
QTSCIPIPTPGHRDRMAELKKVLATGPWQGRLEVVGAGVRGVSVGDCVESGKRVGLDWK
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgtcaaatcgcagtactcggtggtggcttgactgggctttcctcagcctttcat
ctttctcgtcgatttcctgaagcatctatcactttactcgagaagggcccgcatctagga
ggatgggtttccagtgaacgcgtctctgttactcatccagagggtcatactgcggaagtg
atcctggaaaccggtcctagaacacttagaccgaacgcgaaatcggttctcgagctgatt
catctcctcggactcaggaatttgttgaaaacgactccgaccactgcgtcggcagcaaaa
cttcgatatttgcagattccggaatcccaggaactcgtttcgatcccaacatccgttctt
tccagcctctcctcgcctttacgtcccatcctcgtgccatatgtcctcaaggaacccatg
aagcgtgccaatcgacccgcgggcttaactgacgagtcgctcgacagtttcatgagccga
acattcgggagcgctctagtgcacgggatttacgctgctgattcgcgcaagctgagcgtt
cgagctgcgtttccgtctctctgggacgccgaggaacgcggctggggtagcgtcgttcga
ggatttttggtgcctacgaagcacaagtcatcccaagctgattcagattatgaattgggt
gatatcctccagctcatgaatagggtctccgtattcacctttcgagatgggatcagtaca
ataacgaatggtctggtcgaccatttgaagcagagacccaacgtgaagctcttggcgaat
gctggtgcagagaaactcgaactagcagatggcaagattctgctcacaacttctaataat
aacatcatgaagccgacccacgttgtatccgcgcttccactccatattcttcactctatt
ctctctgacaaagaagcgctgccccacctcacggccaacccattttcgtccattaccgtc
atcaacctcgtgttcccgctagatccaaagaagccccggttgcatcctccagggttcgga
tatctaatacctcgacccgtcactgggtacggaccaacggatgcaggaattttaggcacc
gtttttgactcatatgagaaatactttgccaacatgaccgtcatggcgggtggtccatat
ccaacaatgccagatctagacgccgtattgaaacatctctctactcacctggcagagggg
gagacggactcatattctgcgaaagaacttccgcagcctatcctggtccgcacaacccat
cagacgtcgtgtattccaatacctactccaggtcatcgtgatcgaatggctgaattaaaa
aaagtgttagctactggaccttggcagggaagactagaggttgtgggtgctggtgtgcgt
ggtgtcagcgtaggtgactgcgtggaatccggaaaacgagtgggcctagactggaagtga

DBGET integrated database retrieval system