KEGG   Moniliophthora perniciosa: MPER_12953Help
Entry
MPER_12953        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
mpr  Moniliophthora perniciosa
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:mpr04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 154 aa AA seqDB search
MRLSFCLFAAAIIAGVSASNVIDLSPDNWDDVVGKGKPGLVEFFAPWCGHCKNLAPTYEQ
LGDAFAHAKDKVYIAKIDADGVGKEIAQKYGVSGYPTLKWFTADGKDEVFEGSRDIDGLA
GYVSKQSNVKSNIKPPPPPDYLILDVHTFDEVAL
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgagactctcgttctgtctttttgccgctgcaataatagcaggcgtctctgcctccaat
gtcatagatctctctccagacaactgggatgacgtcgtcggaaaaggaaaaccgggatta
gtggaattcttcgctccctggtgtggtcattgcaagaaccttgcacccacgtacgagcaa
ctcggagatgcgtttgcacatgccaaagacaaagtctacatcgcgaagatagatgctgac
ggtgttggaaaggagatcgcgcagaaatacggtgtgtcgggctaccccacgttaaagtgg
ttcaccgccgacggaaaggatgaggtctttgaaggcagccgtgacattgatggattggct
ggatatgtgtccaagcagtcgaacgtcaagtcgaatatcaagcctcctcctccgcccgat
taccttatccttgatgtccatacattcgacgaggtcgctttg

DBGET integrated database retrieval system