KEGG   Moniliophthora perniciosa: MPER_13452Help
Entry
MPER_13452        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
mpr  Moniliophthora perniciosa
Brite
Enzymes [BR:mpr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     MPER_13452
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 105 aa AA seqDB search
IPMNLSSSQWVPSYHCQFQCNGLIFIPXYAHREDKKALADDETYENFHPTFTYPIYGEDE
KIYGYRDLKIDLRFTSGSLINYLSVTWSEKLASKAQTTVDDVEGT
NT seq 317 nt NT seq  +upstreamnt  +downstreamnt
attccaatgaatctctcttcctctcaatgggtaccctcgtatcactgtcaattccaatgc
aatggactcatttttatcccaangtacgctcaccgcgaagacaaaaaggccctcgccgac
gatgaaacatacgaaaacttccatccaacattcacatatcccatatacggcgaagacgag
aagatttacgggtacagagacttgaaaattgaccttcgcttcacctctggttctctcatc
aactacctctccgtaacatggtcagaaaagcttgcttcgaaagcacaaacgacggtggat
gacgtggagggcacttt

DBGET integrated database retrieval system