KEGG   Moniliophthora perniciosa: MPER_14040Help
Entry
MPER_14040        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
mpr  Moniliophthora perniciosa
Brite
Enzymes [BR:mpr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     MPER_14040
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 58 aa AA seqDB search
FRKWFFLHAAIVSPFTFVFDAPFGRFAPKGESIFLIDGIKAWIVMEIISPIFFTCTYL
NT seq 179 nt NT seq  +upstreamnt  +downstreamnt
gttttcgtaaatggttcttcctgcacgccgccattgtttccccctttacctttgtatttg
atgcgccatttggtcgatttgcaccaaagggcgaaagcatctttttgattgacggcatca
aagcttggatcgtcatggaaatcatttcgcccatcttcttcacatgcacatacctctaa

DBGET integrated database retrieval system