KEGG   Moniliophthora perniciosa: MPER_14454Help
Entry
MPER_14454        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
mpr  Moniliophthora perniciosa
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    MPER_14454
Enzymes [BR:mpr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     MPER_14454
Exosome [BR:mpr04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   MPER_14454
  Exosomal proteins of colorectal cancer cells
   MPER_14454
  Exosomal proteins of bladder cancer cells
   MPER_14454
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 131 aa AA seqDB search
MRCISXSALALALTSVVLADSTGADSAGANSSAEAASDVISLTAQDFDAKVNPEPLILVE
FFAPWCGHCKKLAPEYEVAATALKEKNIKLAKVDCVDQADLCQANEVQGYPTLKVFRHGV
PTDYGGHDSQT
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgcgctgcatctcctnatcagcgcttgctcttgcactcacctcggtcgtccttgccgac
tctacaggagctgactctgcaggggccaactcctctgcagaggccgcctcagacgttatt
agtttgacggcgcaagatttcgatgcaaaggttaaccccgagcctctcattctcgtagag
ttctttgctccttggtgtggtcactgcaaaaaattggcacccgaatacgaggtagcagcg
actgctctcaaggaaaagaacatcaagttggccaaggttgactgcgtcgaccaggcagat
ctctgccaggctaatgaggttcaggggtaccccactctcaaagtatttagacacggtgta
cccactgactatggaggtcacgacagtcagacg

DBGET integrated database retrieval system