KEGG   Moniliophthora perniciosa: MPER_14519Help
Entry
MPER_14519        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
mpr  Moniliophthora perniciosa
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:mpr03030]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:mpr03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:mpr03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mpr03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 71 aa AA seqDB search
PVNITQLHKATQAHADSEWQLENAELGQITLVAQVVDITKQTTNTNYKLEDGSGVIEARH
GSDQNSEDDHQ
NT seq 217 nt NT seq  +upstreamnt  +downstreamnt
accggtcaatattacccaactacacaaagccactcaggcgcacgcggactcggaatggca
gctggaaaacgcagagcttgggcagattacacttgtagcacaagtggtggacattacaaa
gcaaactaccaataccaactataaattagaagatggttccggtgtcatagaagctcgcca
tgggagtgatcagaacagcgaagacgaccaccaatga

DBGET integrated database retrieval system