KEGG   Moniliophthora perniciosa: MPER_14519Help
Entry
MPER_14519        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
mpr  Moniliophthora perniciosa
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    MPER_14519
   03420 Nucleotide excision repair
    MPER_14519
   03430 Mismatch repair
    MPER_14519
   03440 Homologous recombination
    MPER_14519
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 71 aa AA seqDB search
PVNITQLHKATQAHADSEWQLENAELGQITLVAQVVDITKQTTNTNYKLEDGSGVIEARH
GSDQNSEDDHQ
NT seq 217 nt NT seq  +upstreamnt  +downstreamnt
accggtcaatattacccaactacacaaagccactcaggcgcacgcggactcggaatggca
gctggaaaacgcagagcttgggcagattacacttgtagcacaagtggtggacattacaaa
gcaaactaccaataccaactataaattagaagatggttccggtgtcatagaagctcgcca
tgggagtgatcagaacagcgaagacgaccaccaatga

DBGET integrated database retrieval system