KEGG   Moniliophthora perniciosa: MPER_14683Help
Entry
MPER_14683        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
mpr  Moniliophthora perniciosa
Pathway
Basal transcription factors
Nucleotide excision repair
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:mpr03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:mpr03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 69 aa AA seqDB search
SGSQQGFIVLETNYRVYAYTGSFSLHNPLQTAILHLFVSLKYRFPNLVVGSITRESVKKA
LSNGISADQ
NT seq 208 nt NT seq  +upstreamnt  +downstreamnt
ctcgggctctcaacaaggcttcattgttcttgagacgaactatcgggtctacgcttacac
aggctcgttttccttacacaacccattacaaaccgctattctccacctctttgtctcctt
aaagtatcggttccccaacctagttgtcggctccatcactcgcgagagcgtaaagaaggc
cctgagcaatgggatttctgctgatcaa

DBGET integrated database retrieval system