KEGG   Moniliophthora perniciosa: MPER_15155Help
Entry
MPER_15155        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mpr  Moniliophthora perniciosa
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MPER_15155
Enzymes [BR:mpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     MPER_15155
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 206 aa AA seqDB search
LYKGANYAILPKKPIHANTTHLLLQNEIPLSESLDYLAEASSRGIVTIFNPSPMPKDEEL
KSFPWHQLTWLIVNEGEANDMYKILTSRSDSTSREVIDVGKSPYADVLAYPVALRLSSQM
PETNIVCTLGGYGVLILLPTLRDAAGLPEPIFLPAAKLEHGVVDTTGAGDCFTGYMAAGL
MKLQHQKSSNSLNREDVVNVMKRCVQ
NT seq 620 nt NT seq  +upstreamnt  +downstreamnt
ttctctacaaaggcgccaactatgctatcctacctaaaaaaccaatccacgcaaacacaa
cgcatctccttctccaaaacgagatacccttgagcgaatccctcgactatctcgcagaag
cctcttctcggggcattgtaaccatcttcaacccttcacccatgccaaaggacgaagaac
tcaagtcttttccttggcaccaactcacttggctcattgttaatgaaggagaggccaacg
acatgtacaagatcctcacctctcgatctgactctaccagtagagaagtgattgacgtgg
gcaagtcgccctatgccgacgtcctggcgtacccagtggcattacgtctatcctcccaga
tgcccgagacgaatatcgtctgtacactaggtggatatggcgtgttgatccttcttccta
cgctccgagatgcagctgggcttcccgaaccgatttttctgcccgcggcaaagttggagc
atggcgttgttgatactacgggtgctggggactgttttactgggtatatggcagcggggt
tgatgaagctccaacatcagaagagttcgaattcgcttaaccgtgaagacgtggttaatg
tcatgaagcgatgcgtgcag

DBGET integrated database retrieval system