KEGG   Moniliophthora perniciosa: MPER_15223Help
Entry
MPER_15223        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
mpr  Moniliophthora perniciosa
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 210 aa AA seqDB search
SEEGGDEIPDPIHQDDEDDDEEDRPLAARMAQKTASKSSKKSGKAPKKVAAASRVPATSA
HLNGRMNGTTEIESKVKIEDKMDETQLDRLATGMPVDAAEPAAPPVKTEKAAIIELRKGI
IEVTAVENDKEPRSLVILTGLKTLFQKQLPKMPREYIARLVYDSNSKALAIIKRGLKVVG
GICYRPFPQRGFAEIVFFATASVDQVKVGS
NT seq 635 nt NT seq  +upstreamnt  +downstreamnt
gaagtgaagaaggtggtgatgagattcccgatcctatacaccaggacgacgaagatgacg
acgaggaagaccgtcctctggccgctcgtatggcccagaaaacagcatccaagtcttcga
agaagagtggtaaagctcctaaaaaggttgcagcagcttcaagggtgccagcgacttcag
cccatttgaacgggcggatgaatggcaccactgaaatcgaatcaaaagtcaaaatcgaag
acaagatggacgagacgcagttagatcggcttgctactggaatgccagtggacgctgcag
agcctgccgctccacctgtcaaaaccgagaaagcggcgatcattgaactgaggaagggta
tcatcgaagtcacggccgttgaaaatgacaaggaaccacgctcattagttattctcactg
ggcttaaaacactcttccaaaagcaactacccaagatgcctcgagagtacatcgcgcgtt
tggtatacgacagcaactcgaaagcccttgccatcatcaagcgtggcctcaaggtcgttg
gaggaatatgttaccgtccatttcctcagagaggcttcgcagagattgttttctttgcga
ctgcttccgtagatcaagtcaaggtaggtagttga

DBGET integrated database retrieval system