KEGG   Moniliophthora perniciosa: MPER_15547Help
Entry
MPER_15547        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
mpr  Moniliophthora perniciosa
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    MPER_15547
Translation factors [BR:mpr03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    MPER_15547
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 123 aa AA seqDB search
GIKKISAFSSPTTDYLLFHSGIRRPVWEDPLNITGGKWIIRLKKGVADRIWEDLVLAILG
DQFDECRQAPDNAAEVANSWEDSSDSDTEWPEICGCTISVRQSEDIVSLWNRVEVDIKVR
ERI
NT seq 373 nt NT seq  +upstreamnt  +downstreamnt
aagggattaaaaagatttccgcctttagttcgcccacaaccgactaccttcttttccatt
ccggaattcgcagacccgtatgggaagatccattgaacattactggaggcaaatggatca
ttcgactcaaaaagggcgttgcagatcgcatctgggaggacctcgttctcgctatcctcg
gtgatcagtttgacgagtgtcgacaggctccagataatgctgcagaagtcgctaatagtt
gggaagatagcagcgactcggacacggagtggcccgaaatctgcggttgtacgataagtg
tccgtcagagcgaggatatcgtcagtttgtggaatcgggtagaggttgatattaaagtca
gggagagaattag

DBGET integrated database retrieval system