KEGG   Moniliophthora perniciosa: MPER_15900Help
Entry
MPER_15900        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K01697  
cystathionine beta-synthase [EC:4.2.1.22]
Organism
mpr  Moniliophthora perniciosa
Pathway
Glycine, serine and threonine metabolism
Cysteine and methionine metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Methionine degradation
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MPER_15900
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MPER_15900
   00270 Cysteine and methionine metabolism
    MPER_15900
Enzymes [BR:mpr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.22  cystathionine beta-synthase
     MPER_15900
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 104 aa AA seqDB search
MPQILNSALDAVGNTPLIRLDRIAKQYGLKCNLLGKVEYMSAGGSVKDRIAKAMVEAAER
DGKLIPGKSVVIEPTSGNTGIGLAMACAIKGYSVIITMPHKMSL
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgcctcagatactcaacagcgccctcgatgccgtcggaaatacacccctgattcgcctg
gaccgaatcgcgaaacaatatggtctcaaatgcaatctacttggtaaagtcgagtacatg
tctgctggcggctcagtaaaggatcgtattgcgaaagcgatggtcgaggctgcagagagg
gatggcaagttgataccgggtaagagtgttgtcatcgagcccacgtctgggaatacaggt
atcggtcttgccatggcttgcgccatcaaggggtattcggtgatcatcaccatgcctcat
aaaatgtcattg

DBGET integrated database retrieval system