KEGG   Moniliophthora perniciosa: MPER_15900Help
Entry
MPER_15900        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K01697  
cystathionine beta-synthase [EC:4.2.1.22]
Organism
mpr  Moniliophthora perniciosa
Pathway
Glycine, serine and threonine metabolism
Cysteine and methionine metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Methionine degradation
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mpr01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mpr00260]
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:mpr00270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 104 aa AA seqDB search
MPQILNSALDAVGNTPLIRLDRIAKQYGLKCNLLGKVEYMSAGGSVKDRIAKAMVEAAER
DGKLIPGKSVVIEPTSGNTGIGLAMACAIKGYSVIITMPHKMSL
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgcctcagatactcaacagcgccctcgatgccgtcggaaatacacccctgattcgcctg
gaccgaatcgcgaaacaatatggtctcaaatgcaatctacttggtaaagtcgagtacatg
tctgctggcggctcagtaaaggatcgtattgcgaaagcgatggtcgaggctgcagagagg
gatggcaagttgataccgggtaagagtgttgtcatcgagcccacgtctgggaatacaggt
atcggtcttgccatggcttgcgccatcaaggggtattcggtgatcatcaccatgcctcat
aaaatgtcattg

DBGET integrated database retrieval system