KEGG   Moniliophthora perniciosa: MPER_15940Help
Entry
MPER_15940        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K05759  
profilin
Organism
mpr  Moniliophthora perniciosa
Brite
Exosome [BR:mpr04147]
 Exosomal proteins
  Proteins found in most exosomes
   MPER_15940
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 58 aa AA seqDB search
MSWQAYVDTNLVGSGKVSKAAILGQGGGVWATSPGFDISPEEQKAIVSGFNSPEGGVA
NT seq 175 nt NT seq  +upstreamnt  +downstreamnt
atgtcctggcaagcatacgtcgataccaacctcgtcggaagtggaaaggtcagcaaagct
gccattctcgggcaaggtggaggtgtttgggcaacctctccgggattcgacatctcgccc
gaggaacagaaggcaattgtcagtggattcaacagcccagagggaggtgtagcaa

DBGET integrated database retrieval system