KEGG   Moniliophthora perniciosa: MPER_16175Help
Entry
MPER_16175        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
mpr  Moniliophthora perniciosa
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:mpr00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 99 aa AA seqDB search
MARAVGFILVPFIIYLSFFYVHFALLPMSGPGDTFMSPAFQETLVGNEMLMNSLEIRYFD
TVTMKHKDTKVFLHSHVDKYPLKYDDGRISSQGMLMSVL
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atggcaagagccgtgggattcatccttgtcccgttcattatctacctttccttcttctat
gtccactttgctctgctccctatgtcaggccccggcgataccttcatgagccctgcgttc
caggagactttagttggtaatgaaatgcttatgaacagcttagaaatcagatactttgat
accgtgaccatgaaacacaaagataccaaagtctttttacattcccacgttgacaaatac
cccctcaagtacgatgatggtcgtatcagcagtcagggtatgcttatgtctgtattatga

DBGET integrated database retrieval system