KEGG   Moniliophthora perniciosa: MPER_16175Help
Entry
MPER_16175        CDS       T01089                                 

Definition
(GenBank) hypothetical protein
  KO
K00728  dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
mpr  Moniliophthora perniciosa
Pathway
mpr00514  Other types of O-glycan biosynthesis
mpr00515  Mannose type O-glycan biosynthesis
mpr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosyntheis
    MPER_16175
   00514 Other types of O-glycan biosynthesis
    MPER_16175
Enzymes [BR:mpr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     MPER_16175
Glycosyltransferases [BR:mpr01003]
 O-Glycan biosynthesis
  O-linked Man type
   MPER_16175
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMT
Motif
Other DBs
NCBI-ProteinID: EEB86752
UniProt: E2M6E9
AA seq 99 aa AA seqDB search
MARAVGFILVPFIIYLSFFYVHFALLPMSGPGDTFMSPAFQETLVGNEMLMNSLEIRYFD
TVTMKHKDTKVFLHSHVDKYPLKYDDGRISSQGMLMSVL
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atggcaagagccgtgggattcatccttgtcccgttcattatctacctttccttcttctat
gtccactttgctctgctccctatgtcaggccccggcgataccttcatgagccctgcgttc
caggagactttagttggtaatgaaatgcttatgaacagcttagaaatcagatactttgat
accgtgaccatgaaacacaaagataccaaagtctttttacattcccacgttgacaaatac
cccctcaagtacgatgatggtcgtatcagcagtcagggtatgcttatgtctgtattatga

DBGET integrated database retrieval system