KEGG   Moniliophthora perniciosa: MPER_16206Help
Entry
MPER_16206        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K14298  
mRNA export factor
Organism
mpr  Moniliophthora perniciosa
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    MPER_16206
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 105 aa AA seqDB search
PTTKDQSLVYAVNDISFHPVHGTFSTCGSDGTIHFWDKDARTRLKTFEPAPGPIACSAFN
RTGSIFAYAISYDWSKGHSGMTPGHPNKLMLHACKEEEVKKRPRK
NT seq 319 nt NT seq  +upstreamnt  +downstreamnt
tccgaccactaaagaccaatcgttggtctacgctgtcaatgatatttcgttccatcctgt
tcatggcaccttctctacatgcggctccgacgggacgattcacttttgggacaaagatgc
gcgtactcggttaaagacgttcgaacccgcacccggtcccatcgcttgtagcgctttcaa
ccgcaccggaagtatttttgcgtacgccatctcctacgactggtcaaagggtcattctgg
tatgacccccggtcatccgaacaaattgatgttgcatgcttgtaaagaggaggaggtcaa
gaagagacccagaaagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system