KEGG   Moniliophthora perniciosa: MPER_16264Help
Entry
MPER_16264        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
mpr  Moniliophthora perniciosa
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MPER_16264
Enzymes [BR:mpr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     MPER_16264
Glycosyltransferases [BR:mpr01003]
 Polysaccharide
  Storage polysaccharide
   MPER_16264
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 127 aa AA seqDB search
MEVEQQEPTDPHLAATLDNMRSQGVKALYGRWLIEGAPRVLLFDTGSQYSRIDEWKADLW
NLAGIPSPPNDHETNETIVFGYLVAWFLGDYVSRQLTTAVVAHFHEWQAGLAIPLCRKRH
IDVTTVF
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggaagtcgagcagcaggaacctacagatcctcacttggcggcgaccctcgacaatatg
cgctcccagggtgtcaaggccctctacggccgatggctcatcgaaggtgcaccccgggtc
cttcttttcgataccggtagccaatattcgagaatcgacgaatggaaagccgatctttgg
aatcttgctggcattccatcaccccccaacgatcacgaaacaaacgaaactatcgttttt
ggttatctcgtagcttggttcttgggcgactacgtttcacgccagctcacaaccgccgtt
gttgctcactttcacgaatggcaagcgggcctcgcgatcccgctctgtaggaaaaggcat
attgacgtcacaaccgtcttc

DBGET integrated database retrieval system