KEGG   Moniliophthora perniciosa: MPER_16420Help
Entry
MPER_16420        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
mpr  Moniliophthora perniciosa
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MPER_16420
Enzymes [BR:mpr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     MPER_16420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 151 aa AA seqDB search
EYYTNLYHQIYASPDYTPILRNTPWLHMFDDHEIMNDFWPGMSVSSKTFAEAIQPFLLYQ
HNANPPPLSDDVFYYTFQRGDASFFVLDTRSYRDEPANLKNGGHGKRSMLGLRQLEALKA
WIRNGKGWKVVVSGVPMTQVGKFQCSLKDYH
NT seq 457 nt NT seq  +upstreamnt  +downstreamnt
agagtactacaccaatctataccaccagatttacgccagccctgattatacacccatcct
gcgaaatacgccatggctacatatgtttgatgatcatgaaatcatgaatgatttttggcc
tggcatgagcgtctcctcaaaaacgtttgccgaggctatacaaccgttcctgctatacca
gcacaatgcgaatccaccacctttgtctgacgacgtattctactacaccttccagcgggg
agacgcgtctttctttgtactggacacgcgttcataccgtgatgagccggcaaatttgaa
gaatggtggacatggcaagagatcgatgcttgggctacggcaactcgaggctttgaaagc
atggatacggaacgggaagggctggaaggtggttgtcagtggtgttcctatgacacaggt
tggaaagtttcaatgctccttgaaggattatcactga

DBGET integrated database retrieval system