KEGG   Melissococcus plutonius ATCC 35311: MPTP_0030Help
Entry
MPTP_0030         CDS       T01492                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
mps  Melissococcus plutonius ATCC 35311
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:mps00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    MPTP_0030
Enzymes [BR:mps01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     MPTP_0030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(33573..35570)
Genome map
AA seq 665 aa AA seqDB search
MTDFNQFIYGGDYNPNQWSKDIWQEDMQLFKKAHINSATINVFSWSKIQPSENSYDFKEL
DEIIQLLSDENYFIILATSTGALPAWMYKRYPEVARVDYEGRSHKFGQRHNACPNSLVYQ
KFAKRLVKKLAERYGNHPNISCWHVNNEYGGECYCEKCERAFQVWVKDKYKTIDSVNQAW
NMEFLGHTLYDFDEIVAPNRLSEGIGTDKTAFAGISIDYKRFISDSLLNNFKMEKTAIHK
FDTKTPITTNLMGTYKGLDYFKWAKELDIVSWDNYPAYNTPWSMVAMTHVLMRGLKNQPF
MLMEQTPSQQNWQAYNSLKKPGQMRAQSYQTIAHGADTIQFFQLRRSVGACEKFHWAVIE
HCGHEETRVFKECEQLGAELSQLSEVINSQNSSEVGIVFDWDNYWALEYTSGPNVDLTYV
EQIHQYYRYFYEQNISVDMIPVDADFTKYKVVIAPVLYMIKAGMQKALENFVQNGGTLLT
TFMSGIVDQSDNAYLGGYPGPLRKLAGIWVEETDALAPEQTNTLQFNDHTESKCSLICDI
IHLETASSLANYTSNFYAETPVVTKNNFGQGTVYYVGTQLENHALNKVLEMVTTEKQIQS
VINEPTDLEITCRYKGNHAYYFIINFKNQLLSLPQRFIGKKDLLTGKLLENDEKMAAYTT
YLIKE
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgacagattttaatcaatttatttacggtggggattataatccaaatcaatggtcaaaa
gatatttggcaagaagatatgcaattattcaaaaaagcacatattaatagtgccaccatt
aatgttttttcttggtcaaaaatacaaccttcagaaaatagttatgattttaaagaacta
gatgaaatcatccaacttctcagtgatgaaaattattttattattttagccacttcaact
ggtgctttgcctgcttggatgtacaaaagatatccagaagtagcacgtgtagactatgaa
ggtcgttcgcataaatttgggcaacggcacaacgcttgtccaaacagtttagtctatcaa
aaatttgcaaaaagattggtaaaaaaactagccgaacgctatggaaatcatccaaatata
agttgttggcatgttaacaatgaatatggtggtgagtgttattgtgaaaaatgtgaaaga
gcttttcaggtatgggtgaaagataagtataaaactattgattcggtaaatcaggcttgg
aatatggaatttttggggcataccctatatgacttcgatgaaattgttgctccaaatcgt
ttatcagaaggtattggtactgataaaacagcttttgctggtatctctattgattacaaa
cgttttatttcagatagcttgcttaacaattttaaaatggaaaaaacagccatccataaa
tttgacactaaaacaccgattacaactaatttaatgggtacttataaaggattggattat
tttaaatgggccaaagaattagatattgtctcctgggataattatcctgcttacaatact
ccttggagcatggtagctatgacgcatgttttaatgcgtggcttaaaaaaccaaccattc
atgctaatggagcaaacaccttcacaacaaaattggcaggcctataattcactaaaaaaa
ccaggacaaatgcgcgcacaaagctatcaaacaattgctcacggtgcggatacaatacaa
tttttccaattacgacgttctgttggtgcctgtgaaaaattccattgggcagtcattgaa
cattgtggacatgaagagacacgtgtatttaaagaatgtgaacaattgggagctgaatta
agtcagctatcagaggttattaatagtcaaaatagctcagaagtaggtattgtctttgat
tgggataactactgggccttagaatataccagtggtcctaatgttgatttaacctatgta
gaacaaattcatcaatattatcgttacttttatgaacaaaacatttctgttgatatgatt
cctgttgatgcagactttacaaaatataaagtggtcattgctcctgtactatatatgata
aaagcaggaatgcaaaaagcattagaaaattttgtacaaaatggtgggacattattaacg
actttcatgagtggaatcgttgaccaatcagataatgcctacttgggtggttatcctggt
ccactaagaaaactagcggggatttgggtagaggagacagatgctttagcacctgaacaa
acaaacactctgcaattcaatgatcatacagaaagtaagtgtagtttgatatgtgatatc
attcatttagaaacagccagctcacttgctaattatacaagtaatttctacgcagaaaca
cctgttgtaacgaaaaataattttggtcagggaactgtttattacgttggtacccaatta
gaaaatcatgccttaaataaagtattagaaatggtaacaacagagaagcaaattcaatcc
gtcataaatgaaccaactgatttagagatcacttgccgttataaaggaaatcacgcctat
tatttcatcatcaattttaaaaaccaattattatcattaccacaacggtttattggtaaa
aaagacttactgactggaaaattactagaaaatgatgaaaagatggccgcttatacaacc
tatctgataaaagaataa

DBGET integrated database retrieval system