KEGG   Melissococcus plutonius ATCC 35311: MPTP_0036Help
Entry
MPTP_0036         CDS       T01492                                 

Definition
glutamyl-tRNA synthetase (EC:6.1.1.17 6.1.1.24)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
mps  Melissococcus plutonius ATCC 35311
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:mps00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
44217..45677
Genome map
AA seq 486 aa AA seqDB search
MTKVRVRYAPSPTGHLHIGNARTALFNYLFARHNDGDFIIRIEDTDQKRNIEGGEKSQLE
NLKWLGVDWDESPDNPGAYGPYRQSERKDIYQPLIDQLLSSNRAYKCYCTPEELKEEREG
QKALGEMPHYAGKCANLTPSEQAENEAKGLIPVIRFRVPRNTSYTFNDMVKGEIVFESDN
IGGDFVIQKQDGMPTYNFAVAVDDHLMKITHVLRGDDHIANTPKQLMIYEAFGWTPPIFG
HMTLIINAATGKKLSKRDETILQFIEQYRELGYLPEAMLNFTTLLGWSPVGEEEIFSQRE
LIDMFDPKRLSKSPAAFDAKKLAWVNNQYVKKMDLHELTEMCIPYLIADGRVEKEPSSEK
IQWLENMVHLYQPQMSYAAEMVDLSALFFNEHPVLDDAAKEALSGETTPIVLSNFKDQLE
KLVIFDAPSIKAAIKTVQKETGIKGKPLFMPIRVAVSGQTHGPELAETIELLGKEKVLNH
LNNVLS
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgactaaggttcgcgtacgctatgcaccaagtccaactgggcatttacatattggtaat
gcaagaacagcactatttaactatctatttgctcgccacaatgatggagattttattatt
cgaattgaggataccgaccaaaaaagaaatattgaaggcggtgaaaaaagtcagcttgaa
aacttaaaatggctaggtgttgattgggacgaatcacctgacaatccaggagcctacggc
ccttatcgtcaatctgagcgaaaagatatctaccaacctttaattgatcaacttttgagc
agtaatcgtgcttataaatgttattgtacgcctgaagaattaaaagaagaaagagaaggt
caaaaagcacttggtgaaatgccgcattatgctggtaaatgtgcgaatttaacaccaagt
gagcaagcagaaaatgaagctaagggattaattccagttattcgttttcgtgtccctaga
aatacttcttatacgtttaatgatatggttaagggagagattgtttttgagtctgacaat
atcggtggagattttgtcattcaaaagcaagatggtatgccaacttataattttgcggtt
gctgttgatgatcatcttatgaaaattacccatgttctacgtggagacgatcatattgct
aatacaccaaaacaattaatgatctatgaagcttttggttggacaccgcctatttttggc
catatgacattaatcattaatgccgcaactggtaaaaaattaagtaaacgtgatgaaaca
attttacaatttattgaacaatatcgtgaactaggttacctaccagaagcaatgttaaac
tttacgacattgttaggttggtctccagtaggcgaagaagaaatcttttcacaaagagaa
ttaattgatatgtttgatccaaaacgtttaagtaaatcacctgctgcttttgatgcaaaa
aaattagcttgggtaaacaatcaatatgtgaaaaaaatggatttacatgaattaacagag
atgtgtataccatacttaatcgctgatggacgggtagaaaaagagccatcatcagagaag
atccaatggctggaaaatatggttcatctatatcaacctcaaatgagttatgctgcagaa
atggttgatttatctgcattatttttcaatgaacatcccgttcttgatgatgcagcaaaa
gaagcgttaagtggagaaaccacaccaatcgtcctatcgaactttaaagaccaattagaa
aaattagtaatttttgatgctcctagtataaaagcagcaattaagacagttcaaaaagaa
acaggaattaagggtaaaccacttttcatgcctatccgggttgctgtatcaggacaaaca
catggaccagaactagctgaaacgattgaattgttaggaaaagaaaaggttctaaatcat
ttaaataatgtgcttagctaa

DBGET integrated database retrieval system