KEGG   Melissococcus plutonius ATCC 35311: MPTP_0149Help
Entry
MPTP_0149         CDS       T01492                                 

Definition
(RefSeq) preprotein translocase secY subunit
  KO
K03076  
preprotein translocase subunit SecY
Organism
mps  Melissococcus plutonius ATCC 35311
Pathway
Protein export
Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:mps00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    MPTP_0149
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    MPTP_0149
Secretion system [BR:mps02044]
 Sec (secretion) system
  Bacterial Sec-SRP core components [MD:M00335]
   MPTP_0149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
146509..147804
Genome map
AA seq 431 aa AA seqDB search
MFRLLNNAFKVKDIRSKLFFTLFVLFVFRLGTHITVPGVDAKGLSDLSNLPFLNMLNMVS
GSAIQNFSIFSMGVSPYITASIIIQLLQMDIVPKFVEWSKQGEVGRKKLNQATRYLTIVL
GIAQSMGITAGFNSLSQTGIVKHPSFGTFVMIAVILTSGTMFVTWLGEQITEKGIGNGVS
MIIFAGIISRLPDSIKSLVDDYFINIESSKIWQSVIFMLILIIAILVIVTFVTFFQQAER
KIPIQYTKRMTGAPTSSYLPLKVNAAGVIPVIFASSLIATPNALLQAFTKYSGEGWYDVM
TKIFSYNTVPGATVYTVLIVAFTFFYAFVQVNPEKLAENLQKQGSYIPSVRPGKGTESYV
SSVLMRLSVVGAIFLGLVALLPIIAQMIWKLPQSIGLGGTSLLIVIGVALETAKQLEGLM
LKRRYVGFINK
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgactattaaataacgcttttaaggtaaaagacattagatcaaaactttttttc
actttgtttgttttatttgtgttccgattaggaacacatattaccgttcctggagtagat
gcgaagggattatccgatttaagtaatcttccatttttgaatatgttgaatatggttagt
ggtagtgccattcaaaatttctcaattttttcaatgggtgtctctccctatattactgct
tcaattattattcaattattacaaatggacattgtaccaaaattcgttgagtggtcaaaa
caaggcgaagtaggacgtaagaaattaaatcaagcaacacgttacctaactatcgtatta
ggtattgctcaatctatgggaattacggctggatttaatagcttaagtcagacaggaatt
gttaaacatccttcttttggaacttttgttatgattgctgttattctaacttcagggaca
atgtttgttacttggttaggagaacagattactgagaagggaatcggtaatggtgtttct
atgattatctttgcaggaatcatttcaagattaccagattcgatcaaaagtttagtggat
gattattttatcaatattgaatcttccaaaatttggcaatctgttatcttcatgctgatt
ttaattattgcaattttggttattgttacgtttgtaactttttttcaacaagcagaaaga
aaaataccaattcaatatacaaaacgaatgactggtgcaccaacaagcagttatttacct
ttaaaagttaatgctgcaggtgttattcctgttatttttgccagttcattaattgcgaca
ccgaatgcacttttgcaggcatttacaaaatattcaggtgaaggttggtacgatgttatg
actaaaatttttagttataatacagtacctggtgcaactgtttatactgtattaatcgtt
gcctttacgtttttctatgcattcgtacaagtaaatcctgagaaattagctgaaaactta
caaaaacaaggtagttatattccaagtgttagaccaggcaagggaactgagagttatgtt
tccagtgtgttaatgcgattaagtgttgtaggagctatttttctaggactagttgctttg
ttaccaattattgctcaaatgatctggaaattacctcaatctataggtcttgggggaacc
agtttattaattgtaattggagtagctcttgaaactgcaaaacaattagaaggactaatg
ctaaaacgtcggtacgttggttttattaacaaataa

DBGET integrated database retrieval system