KEGG   Melissococcus plutonius ATCC 35311: MPTP_0149Help
Entry
MPTP_0149         CDS       T01492                                 

Definition
preprotein translocase secY subunit
Orthology
K03076  
preprotein translocase subunit SecY
Organism
mps  Melissococcus plutonius ATCC 35311
Pathway
Protein export
Bacterial secretion system
Class
Genetic Information Processing; Folding, sorting and degradation; Protein export [PATH:mps03060]
Environmental Information Processing; Membrane transport; Bacterial secretion system [PATH:mps03070]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
146509..147804
Genome map
AA seq 431 aa AA seqDB search
MFRLLNNAFKVKDIRSKLFFTLFVLFVFRLGTHITVPGVDAKGLSDLSNLPFLNMLNMVS
GSAIQNFSIFSMGVSPYITASIIIQLLQMDIVPKFVEWSKQGEVGRKKLNQATRYLTIVL
GIAQSMGITAGFNSLSQTGIVKHPSFGTFVMIAVILTSGTMFVTWLGEQITEKGIGNGVS
MIIFAGIISRLPDSIKSLVDDYFINIESSKIWQSVIFMLILIIAILVIVTFVTFFQQAER
KIPIQYTKRMTGAPTSSYLPLKVNAAGVIPVIFASSLIATPNALLQAFTKYSGEGWYDVM
TKIFSYNTVPGATVYTVLIVAFTFFYAFVQVNPEKLAENLQKQGSYIPSVRPGKGTESYV
SSVLMRLSVVGAIFLGLVALLPIIAQMIWKLPQSIGLGGTSLLIVIGVALETAKQLEGLM
LKRRYVGFINK
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgactattaaataacgcttttaaggtaaaagacattagatcaaaactttttttc
actttgtttgttttatttgtgttccgattaggaacacatattaccgttcctggagtagat
gcgaagggattatccgatttaagtaatcttccatttttgaatatgttgaatatggttagt
ggtagtgccattcaaaatttctcaattttttcaatgggtgtctctccctatattactgct
tcaattattattcaattattacaaatggacattgtaccaaaattcgttgagtggtcaaaa
caaggcgaagtaggacgtaagaaattaaatcaagcaacacgttacctaactatcgtatta
ggtattgctcaatctatgggaattacggctggatttaatagcttaagtcagacaggaatt
gttaaacatccttcttttggaacttttgttatgattgctgttattctaacttcagggaca
atgtttgttacttggttaggagaacagattactgagaagggaatcggtaatggtgtttct
atgattatctttgcaggaatcatttcaagattaccagattcgatcaaaagtttagtggat
gattattttatcaatattgaatcttccaaaatttggcaatctgttatcttcatgctgatt
ttaattattgcaattttggttattgttacgtttgtaactttttttcaacaagcagaaaga
aaaataccaattcaatatacaaaacgaatgactggtgcaccaacaagcagttatttacct
ttaaaagttaatgctgcaggtgttattcctgttatttttgccagttcattaattgcgaca
ccgaatgcacttttgcaggcatttacaaaatattcaggtgaaggttggtacgatgttatg
actaaaatttttagttataatacagtacctggtgcaactgtttatactgtattaatcgtt
gcctttacgtttttctatgcattcgtacaagtaaatcctgagaaattagctgaaaactta
caaaaacaaggtagttatattccaagtgttagaccaggcaagggaactgagagttatgtt
tccagtgtgttaatgcgattaagtgttgtaggagctatttttctaggactagttgctttg
ttaccaattattgctcaaatgatctggaaattacctcaatctataggtcttgggggaacc
agtttattaattgtaattggagtagctcttgaaactgcaaaacaattagaaggactaatg
ctaaaacgtcggtacgttggttttattaacaaataa

DBGET integrated database retrieval system