KEGG   Melissococcus plutonius ATCC 35311: MPTP_0198Help
Entry
MPTP_0198         CDS       T01492                                 

Definition
lacto-N-biosidase (EC:3.2.1.140)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
mps  Melissococcus plutonius ATCC 35311
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mps00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MPTP_0198
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    MPTP_0198
Enzymes [BR:mps01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     MPTP_0198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
203611..204597
Genome map
AA seq 328 aa AA seqDB search
MIDIGRKFYTIEMLQALIDYMETLKMNVLQLHFSENEGFRLECQTMPELTSKEYLTKKDI
TSLIHYADVRNIMIIPEFDSPGHLKRLLTLHPEFQMSTFAHNKGYLDDPLFDITNPQAVR
LIKEIIQEYIELFSTTHYFHLGADEYLNFNELANYPLLQANAQKKYKNKELGYDLFIDYI
NELADKVEENGLIARVWNDGFYKTDELSKNKLKSTIQITYWTHYQKQMATVQTFIEKGHK
ILNFNDNFFYFVLGEEAGYKYSTGEKIKENWTINVFSGNQQLSKRDMRQVIGTYFAIWSD
NSDALTETEVLTRIKEPLKEQQKKIWQY
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgatagatatcggtagaaagttttatacgattgaaatgttgcaggcgttaattgattat
atggaaactttaaaaatgaatgttctacaattacatttttcggagaatgaaggatttcga
ttagaatgtcaaactatgccagaattgacttcaaaggaatacctaacaaagaaagatatt
actagcttaattcattatgctgatgttcgaaatattatgatcattcctgaatttgatagt
ccaggccatttaaaaaggttgctgacattacatccagaattccaaatgagtacttttgct
cacaataaaggatatttagatgatccactatttgatattacaaatccacaggcagtaaga
ttaatcaaagaaattattcaggagtacattgaactgttttctactacacattattttcat
ttgggtgcagatgaatatctgaattttaacgaattagcaaattatccactcctacaagca
aatgctcaaaaaaaatataagaataaagaattaggttatgatttatttattgattatata
aatgaactagcagataaggtagaagaaaacggtttgatcgctagggtttggaatgatggt
ttttataaaacagatgaattatcaaaaaataaattaaaatcaacgatccaaattacctac
tggacacattatcaaaagcaaatggcgactgttcaaacgtttattgaaaaaggacataaa
attttgaattttaatgacaattttttctattttgttttgggagaagaagccggttataaa
tattcaactggcgagaaaatcaaagaaaactggacaataaatgtgttctcaggaaaccaa
caactttctaaaagagacatgcggcaagttataggcacctattttgcaatttggagtgac
aattcagatgcattaaccgagacagaagtattaacacgtattaaagagcctttaaaagaa
caacaaaaaaagatttggcagtattaa

DBGET integrated database retrieval system