KEGG   Melissococcus plutonius ATCC 35311: MPTP_0235Help
Entry
MPTP_0235         CDS       T01492                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mps  Melissococcus plutonius ATCC 35311
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mps00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MPTP_0235
   01230 Biosynthesis of amino acids
    MPTP_0235
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MPTP_0235
  Energy metabolism
   00680 Methane metabolism
    MPTP_0235
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MPTP_0235
Enzymes [BR:mps01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     MPTP_0235
Exosome [BR:mps04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   MPTP_0235
  Exosomal proteins of melanoma cells
   MPTP_0235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(242932..243618)
Genome map
AA seq 228 aa AA seqDB search
MPKLVFSRHGMSEWNALNQFTGWVDVNLSPEGIEEAKEGGRKIKEAGIDFDIAYTSVLTR
AIKTCNLILEYSDQLWVPQVKSWRLNERHYGKLQGLNKKETAEKYGDEQVHIWRRSYDTL
PPLLEEMDPGSALNDRRYAGLDKRDIPAGENLKVTLERALPFWQDHIAPSLVDDKTVLVA
AHGNSIRALVKHIEGISDDDIMGVEIPTGQPLVYELNTDLSVAKKYYL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaattagttttttctcgtcatggaatgagcgaatggaatgcattaaatcaattt
accggttgggttgatgttaatttatcacctgaaggaattgaagaagcaaaagagggtgga
cgaaaaatcaaagaagctggaattgattttgatattgcctatacttctgtcttaacacgt
gcaattaaaacgtgtaatttaattttagaatattctgaccaactatgggtacctcaagta
aaatcttggcgcttaaatgaacgtcattatggtaaattacaaggcttaaacaaaaaagaa
acagcagaaaaatatggagacgaacaagtacatatctggcgtcgttcttatgatacactg
cctccattattagaagaaatggatccaggttctgccttaaatgatcgtcgctatgctgga
ctggacaaacgtgatattccagctggagaaaatttaaaagttacattggaacgtgcttta
cctttctggcaagatcatattgctccttcattggtagatgacaagactgttttagttgcc
gcacatggtaattctatacgggctcttgttaaacatattgaaggtatttctgatgatgat
attatgggtgtagagattccaacaggtcaaccacttgtttatgaactaaacactgactta
tctgtagctaaaaaatactatctataa

DBGET integrated database retrieval system